Align cyclohexa-1,5-dienecarbonyl-CoA hydratase monomer (EC 4.2.1.100) (characterized)
to candidate RR42_RS28050 RR42_RS28050 3-hydroxypropionyl-CoA dehydratase
Query= metacyc::MONOMER-18320 (256 letters) >FitnessBrowser__Cup4G11:RR42_RS28050 Length = 261 Score = 106 bits (265), Expect = 4e-28 Identities = 80/258 (31%), Positives = 127/258 (49%), Gaps = 25/258 (9%) Query: 11 KDKVATITLNVPNSNWLTIPMMKEINEALMDVKKDPTIQLLVFDHAGDKAFCDGVDVADH 70 KD +AT+TL+ P N + + + ++ AL + +DP ++ +V AG +AFC G D+A+ Sbjct: 14 KDGIATLTLDNPPLNVVFRGLTEALDRALDALARDPAVRAVVLTGAGTRAFCAGSDIAEF 73 Query: 71 VP-----EKVDEMIDLFHGMFRNMAAMDVTSVCLVNGRSLGGGCELMAFCDIVIASEKAK 125 P + V + L H +F + +V VNG + GGG E+ CD+++A E A+ Sbjct: 74 RPLMRPGQIVPGKLALQHAVFGRLDDFPKPTVAAVNGLAFGGGLEIAVCCDLIVADETAR 133 Query: 126 IGQPEINLAVFP----PVAAAWFPKIMGLKKAMELILTGKIISAKEAEAIGLVNVVLPVE 181 PEI L VFP PV + +G +A EL+ G+ I A A A GLVN V P Sbjct: 134 FALPEIKLGVFPGSGGPVRVT---RRVGEGRAKELMFLGEPIDAATALAWGLVNRVAPPG 190 Query: 182 GFREAAQKFMADFTSKSRPVAMWARRAIMAGLNLD------FLQALKASEIIYMQGCMAT 235 +AA A + ++AI L+ D QAL S+ ++ ++ Sbjct: 191 QALQAALALAATLARRPPLALALCKQAI--DLSFDTTEDEAMRQALPLSDRVF-----SS 243 Query: 236 EDANEGLASFLEKRKPVF 253 ++A EG+ +F + P F Sbjct: 244 KEAQEGVRAFFARETPRF 261 Lambda K H 0.322 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 261 Length adjustment: 24 Effective length of query: 232 Effective length of database: 237 Effective search space: 54984 Effective search space used: 54984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory