Align FcbT2, component of Tripartite 4-chlorobenzoate symporter (also binds and may transport 4-bromo-, 4-iodo-, and 4-fluorobenzoate and with a lower affinity, 3-chlorobenzoate, 2-chlorobenzoate, 4-hydroxybenzoate, 3-hydroxybenzoate, and benzoate) (characterized)
to candidate RR42_RS24115 RR42_RS24115 C4-dicarboxylate ABC transporter permease
Query= TCDB::Q9RBR0 (181 letters) >FitnessBrowser__Cup4G11:RR42_RS24115 Length = 172 Score = 126 bits (317), Expect = 2e-34 Identities = 69/168 (41%), Positives = 105/168 (62%), Gaps = 8/168 (4%) Query: 20 RAEEILAAVACGLVLLMVLVICADVTLRATMRSGLT----SASAVAEYSLYAITFLAAPL 75 R + L +AC L+L++V I DV LR + GL +++ ++EY+LY T LAAP Sbjct: 7 RLYDFLMVLACLLLLMIVGSITLDVLLRNLVIPGLPRGFPASNDISEYALYFCTLLAAPW 66 Query: 76 LLRKGQHIRVDLVLRAMPPRAAWLLEWAVDACGAAISGLFLTSSVHVLV--QSYSQSAMV 133 LLR GQHIRVD+VLRA+P + AW EW D A++G + + + V++ +SY+ A+ Sbjct: 67 LLRAGQHIRVDIVLRAVPAKLAWACEWLSDV--IALTGCVVVAWMGVVMAFRSYASGAIQ 124 Query: 134 MREMMFPEWWLYIPMPISLALLTIEFLLRMRRLVQGERQMREEATSAA 181 ++ ++ PEWW+ P+P++ ALL +EF RM RL +R R +A S A Sbjct: 125 IKSIVIPEWWVMAPLPVAFALLAVEFAFRMWRLAHSQRGPRSDAVSTA 172 Lambda K H 0.327 0.134 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 109 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 181 Length of database: 172 Length adjustment: 19 Effective length of query: 162 Effective length of database: 153 Effective search space: 24786 Effective search space used: 24786 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory