Align 2-pyrone-4,6-dicarboxylate lactonase (EC 3.1.1.57) (characterized)
to candidate RR42_RS10620 RR42_RS10620 amidohydrolase
Query= BRENDA::D1MW98 (305 letters) >FitnessBrowser__Cup4G11:RR42_RS10620 Length = 276 Score = 159 bits (401), Expect = 9e-44 Identities = 96/273 (35%), Positives = 143/273 (52%), Gaps = 13/273 (4%) Query: 28 AVDAHCHVFGPGNEFPFAPERKYTPCDASKAQLYALRDHLGFARNVVVQATCHGADNRAM 87 A D H HVF + +P AP TP A A ++ LG +R VVVQ T +G DNR Sbjct: 12 ACDCHIHVFD--DAYPLAPTATSTPPPAPAACYQEVQATLGLSRAVVVQPTGYGFDNRCT 69 Query: 88 VDACKSSGGKARGVATVKRSISDAELQELHDAGVRGVRFNFVKRLVDFTPKDELMEIAGR 147 + A + G ARG+A V++ ++D ELQ LH AG+RGVR+ + P D L +A R Sbjct: 70 LAAIEQLGANARGIAVVRQDVADVELQSLHRAGIRGVRYMMLPG--GLLPWDNLETLAAR 127 Query: 148 IAKLGWHVVIYFEAVDLPELWDFFTALPTTVVVDHMGRPDVTKGVDSEEFALFLKFMREH 207 +A LGW++ + + +LP LP +V+DH+G+ V E F L L+ + E Sbjct: 128 VAPLGWNINLQLDGRELPHREATLGKLPGRLVIDHIGKFLGPVTVQDEAF-LSLRRLLEQ 186 Query: 208 KNVWSKVSCPERLSVSGPKALHGEQNAYQDVVPFARRVVEEFPERVLWGTDWPHPNLKDH 267 + W K+S P + GP Y+D AR + ++PER LW ++WPH N+ + Sbjct: 187 GHCWIKLSAPYESARKGPP-------GYEDAAGLARTLARDYPERCLWASNWPHLNI-NP 238 Query: 268 MPDDGLLVDFIPHIAPTAQLQQKLLVDNPMRLY 300 P D L+D+ T ++ ++LV NP +Y Sbjct: 239 CPGDKDLLDWAFDCMETEAVKHRVLVANPAEVY 271 Lambda K H 0.321 0.138 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 276 Length adjustment: 26 Effective length of query: 279 Effective length of database: 250 Effective search space: 69750 Effective search space used: 69750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory