Align 2-pyrone-4,6-dicarboxylate hydrolase; PDC hydrolase; 2-pyrone-4,6-dicarboxylate lactonase; EC 3.1.1.57 (characterized)
to candidate RR42_RS23430 RR42_RS23430 hypothetical protein
Query= SwissProt::O87170 (293 letters) >FitnessBrowser__Cup4G11:RR42_RS23430 Length = 271 Score = 132 bits (333), Expect = 7e-36 Identities = 84/268 (31%), Positives = 126/268 (47%), Gaps = 12/268 (4%) Query: 27 DAHCHVFGPMAQFPFSPKAKYLPRDAGPDMLFALRDHLGFARNVIVQASCHGTDNAATLD 86 D H H++GP ++P +A Y+P A D L A+ +G VIVQA+ +G ++ A L Sbjct: 9 DCHTHIYGPYDRYPLPKEAVYVPEAAPFDALRAVHKSIGITHGVIVQAANYGPNHCALLA 68 Query: 87 AIARAQGKARGIAVVDPAIDEAELAALHEGGMRGIRFNFLKRLVDDAPKDKFLEVAGRL- 145 A+ G RGIAV+ P I + +LA + G++GIR + L + K + R+ Sbjct: 69 ALDAGNGAYRGIAVISPEIPDEKLAMMAARGVKGIRIGLMSHLGNSFDAGKVRALVERIR 128 Query: 146 PAGWHVVIYFEADILEELRPFMDAIPVPIVIDHMGRPDVRQGPDGADMKAFRRLLD---- 201 P GWH +I+ E + + V +VIDHM R + D D+ A RL D Sbjct: 129 PYGWHALIHGEPENVMAAADAAGHYGVKLVIDHMARLSL----DAPDLTA--RLDDICTL 182 Query: 202 -SREDIWFKATCPDRLDPAGPPWDDFARSVAPLVADYADRVIWGTDWPHPNMQDAIPDDG 260 E +W K + DR+ + + LV R IWGTDWPHPN+ +P D Sbjct: 183 LRHEHVWIKVSGVDRITKGRLDAPEAKAVLQRLVETAPKRAIWGTDWPHPNLTYPVPKDD 242 Query: 261 LVVDMIPRIAPTPELQHKMLVTNPMRLY 288 ++ + + +L NP LY Sbjct: 243 ALLSWLGSAVGDEAMLKAVLSENPASLY 270 Lambda K H 0.323 0.140 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 277 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 271 Length adjustment: 26 Effective length of query: 267 Effective length of database: 245 Effective search space: 65415 Effective search space used: 65415 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory