Align 4-oxalmesaconate hydratase; OMA hydratase; Gallate degradation protein B; EC 4.2.1.83 (characterized)
to candidate RR42_RS27205 RR42_RS27205 GlcNAc-PI de-N-acetylase
Query= SwissProt::Q88JX8 (258 letters) >FitnessBrowser__Cup4G11:RR42_RS27205 Length = 249 Score = 329 bits (844), Expect = 3e-95 Identities = 159/249 (63%), Positives = 193/249 (77%), Gaps = 4/249 (1%) Query: 10 RSQRNMNTPQKSALVVSAHSADFVWRAGGAIALHAEQGYAMHVVCLSFGERGESAKLWRK 69 ++Q + + S LVVSAH+ADFVWRAGGAIAL+AE+GY + +VCLSFGERGESAK+WR+ Sbjct: 5 QAQAQPDAQRPSILVVSAHAADFVWRAGGAIALYAERGYNVKIVCLSFGERGESAKMWRQ 64 Query: 70 GEMTEAKVKDARREEAMAAAEILGASVEFFDIGDYPMRADKDTLFRLADVYRRVQPEFVL 129 MT +VK AR EEA AA+ILGA++E FD+GDYPMR L RLAD+YR ++PE VL Sbjct: 65 PGMTIERVKAARHEEAQQAADILGATLECFDLGDYPMRVTDAALLRLADLYRALRPELVL 124 Query: 130 SHSLKDPYNYDHPLAMHLAQEARIIAQAEGYKPGEKIVGAPPVYAFEPHQPEQCEWRPDT 189 SHS +D YN+DHPLA H+AQEAR+IAQA GYKP ++GAPPV+ FEPHQPEQC W+PD Sbjct: 125 SHSREDIYNFDHPLATHVAQEARVIAQAHGYKPEVPVIGAPPVFLFEPHQPEQCNWKPDV 184 Query: 190 FLDITSVWDKKYAAIQCMAGQEHLWEYYTRVALQRGVQAKRNVGITSARNIVYAEGLQSV 249 LDI+SVW+KK A MA QEHLWEYYTRVALQRG QA RN S R + YAEG V Sbjct: 185 LLDISSVWEKKQRAFATMAAQEHLWEYYTRVALQRGAQAARN----SDRKVQYAEGYARV 240 Query: 250 FPRVTENLA 258 FP+V ++L+ Sbjct: 241 FPQVAQSLS 249 Lambda K H 0.320 0.132 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 249 Length adjustment: 24 Effective length of query: 234 Effective length of database: 225 Effective search space: 52650 Effective search space used: 52650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory