Align Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase; HMG aldolase; EC 4.1.3.17; Oxaloacetate decarboxylase; OAA decarboxylase; EC 4.1.1.112; Regulator of ribonuclease activity homolog; RraA-like protein (uncharacterized)
to candidate RR42_RS34615 RR42_RS34615 dimethylmenaquinone methyltransferase
Query= curated2:Q9KBI9 (210 letters) >FitnessBrowser__Cup4G11:RR42_RS34615 Length = 232 Score = 135 bits (340), Expect = 6e-37 Identities = 71/175 (40%), Positives = 98/175 (56%), Gaps = 3/175 (1%) Query: 7 DFITQFRTIPTTCISDALDGLTNLTSTIKPLNENDQVV--GPARTVQVASGDNLAVLKAM 64 D + FR +P I DA+ T ++P + V GPA TV+V GDNL + KA+ Sbjct: 25 DIVAAFREMPVAAIGDAMSRNIG-TIGLRPYHSRPDTVLCGPAVTVRVRPGDNLMIHKAL 83 Query: 65 YEASPGDVIVIDAKGDCTRAIAGDFVLGMAKTLGIAGFVVDGAIRDIRASKALNFPIFCR 124 PGDV+VID GD T+A+ G + + G V+DGA+RD+ PIF R Sbjct: 84 MMVRPGDVLVIDGGGDITQALVGGLMRTTCVARQLGGLVIDGAVRDVLEWAEDGMPIFAR 143 Query: 125 GTTIAASKKTGIGNINVPISCGGVPIRPGDLIVGDADGVTVIPKGQEENVLQKAK 179 G T K G G +NVP+SC G+ + PGDLIVGDADGV +P + ++LQ+ + Sbjct: 144 GHTHRGPSKDGPGEVNVPVSCAGMAVMPGDLIVGDADGVIAVPAAEAADLLQRTR 198 Lambda K H 0.318 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 210 Length of database: 232 Length adjustment: 22 Effective length of query: 188 Effective length of database: 210 Effective search space: 39480 Effective search space used: 39480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory