Align 4-oxalomesaconate tautomerase; Gallate degradation protein D; EC 5.3.2.8 (characterized)
to candidate RR42_RS23050 RR42_RS23050 4-oxalomesaconate tautomerase
Query= SwissProt::Q88JY0 (361 letters) >FitnessBrowser__Cup4G11:RR42_RS23050 Length = 359 Score = 310 bits (795), Expect = 3e-89 Identities = 171/356 (48%), Positives = 218/356 (61%), Gaps = 5/356 (1%) Query: 6 IPCLLMRGGTSKGAYFLHDDLPAPGPLRDRVLLAVMGSPDARQIDGIGGADSLTSKVAII 65 IPC+LMRGGTS+G F D LP RD+VLL+ MGSP A Q+DG+GG SLTSK AI+ Sbjct: 5 IPCVLMRGGTSRGPLFRADWLPDDPARRDQVLLSAMGSPHALQVDGLGGGSSLTSKAAIV 64 Query: 66 RASQRDDADVDYLFAQVVVDEARVDYGQNCGNILAGVGPFALERGLVAASGASTPVRIFM 125 S+R D+DYLFAQV VD+ RVD NCGN+LA V PFA+E GLV A +T +RIF Sbjct: 65 SCSRRPGCDIDYLFAQVAVDKHRVDTRPNCGNMLAAVAPFAIEEGLVRAGQCATTLRIFN 124 Query: 126 ENTGQIAVAQVPTADGQVEYAGDTRIDGVPGRAAALVVTFADVAGASCGALLPTGNSRDC 185 NT + A V T GQV YAG TRIDGV G AA +++ F D G GA+ PTGN+ D Sbjct: 125 VNTSSVVEAVVQTPGGQVTYAGATRIDGVAGTAAPIMLNFLDAWGRVTGAMFPTGNTIDV 184 Query: 186 VEGVEVTCIDNGMPVVLLCAEDLGVTGYEPCETLEADSALKTRLEAIRLQLGPRMNLGDV 245 ++ V VTCID MP+V++ A LGV G E L+A+ + RLE++R Q G RM LGDV Sbjct: 185 IDAVPVTCIDAAMPLVVVHAASLGVRGDETPAALDANREMLARLESVRRQAGRRMGLGDV 244 Query: 246 SQRNVPKMCLLSAPRNGGTVNTRSFIPHRCHASIGVFGAVSVATACLIEGSVAQGLASTS 305 S +PK L+S + +R F P RCH + V GAV +A A G+VA GLAST Sbjct: 245 SHSVIPKPVLVSGCGRANEITSRYFTPLRCHTAHAVTGAVGIAAAYCTPGTVANGLASTP 304 Query: 306 GGDRQRLAVEHPSGEFTVEISLEH----GVIKGCGLVRTARLLFDGVVCIGRDTWG 357 + R+ V HP+G V + E + GLVRTAR + G++ + + G Sbjct: 305 -SPQGRIVVRHPAGSIEVHVEPERDGGPSPFRRIGLVRTARRIMKGLLSVPGEVMG 359 Lambda K H 0.320 0.138 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 432 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 359 Length adjustment: 29 Effective length of query: 332 Effective length of database: 330 Effective search space: 109560 Effective search space used: 109560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory