Align 2-oxopent-4-enoate hydratase (EC 4.2.1.80) (characterized)
to candidate RR42_RS32645 RR42_RS32645 2-keto-4-pentenoate hydratase
Query= metacyc::MONOMER-14738 (279 letters) >FitnessBrowser__Cup4G11:RR42_RS32645 Length = 260 Score = 338 bits (866), Expect = 9e-98 Identities = 170/260 (65%), Positives = 201/260 (77%) Query: 19 MDNSKIQHYGDELYQSLLDRQPVAPLTDREADITIEDAYQIQLRMIQRRLDAGERVVGKK 78 M I G L+Q+L RQ +APLT+R +++I+DAY+IQL M+Q RLDAGERV+GKK Sbjct: 1 MKPEDILEIGASLHQALDQRQAIAPLTERYPELSIDDAYRIQLAMVQHRLDAGERVIGKK 60 Query: 79 IGVTSKVVMDMLKVNQPDFGHLLSGMVYNEGQPIPVSSMIAPKAEAEVAFILARDLEGPG 138 IGVTS+VVMDML V QPDFGHLLSGMV+ +G I +++IAPKAE E+AF+L DLEGPG Sbjct: 61 IGVTSRVVMDMLDVRQPDFGHLLSGMVHADGTAIAANTLIAPKAEGEIAFVLKEDLEGPG 120 Query: 139 VTAADVLRATDCVMPCFEIVDSRIKDWKIKIQDTVADNASCGVLTLGGLRKSPRDLDLAL 198 VT ADVLRAT V+PCFEIVDSRI+DWKI+I DTVADNAS GV LG PR LDL Sbjct: 121 VTNADVLRATAYVLPCFEIVDSRIRDWKIRIPDTVADNASSGVFVLGDAAVDPRGLDLGT 180 Query: 199 AGMVLEKNGEIISTSCGASVQGSPVNAVAWLANTLGRLGIGLKAGDIILSGSQSPLVPVV 258 GM LEKNGEI++T GA+ G P NAVAWLANTLGRLGIGLK G++ILSGS + +VPV Sbjct: 181 VGMTLEKNGEIVATGAGAAALGHPANAVAWLANTLGRLGIGLKKGEVILSGSLAAMVPVQ 240 Query: 259 AGDSLYCSVGGLGGTSVRFV 278 AGD L S+GG+G VRFV Sbjct: 241 AGDQLRISLGGIGSAGVRFV 260 Lambda K H 0.318 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 260 Length adjustment: 25 Effective length of query: 254 Effective length of database: 235 Effective search space: 59690 Effective search space used: 59690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory