Align 3-oxoadipate enol-lactonase (EC 3.1.1.24) (characterized)
to candidate RR42_RS21850 RR42_RS21850 3-oxoadipate enol-lactonase
Query= BRENDA::Q13KT2 (263 letters) >FitnessBrowser__Cup4G11:RR42_RS21850 Length = 262 Score = 258 bits (659), Expect = 9e-74 Identities = 136/262 (51%), Positives = 170/262 (64%), Gaps = 5/262 (1%) Query: 1 MPYAAVNGTELHYRIDGERHGNAPWIVLSNSLGTDLSMWAPQVAALSKHFRVLRYDTRGH 60 M A G LHY I+G NAP +V+SNSLGTD+ MWAPQ+ +L FRVLRYDTRGH Sbjct: 1 MTTALHQGIALHYEIEGAP--NAPVLVMSNSLGTDMQMWAPQMDSLLPRFRVLRYDTRGH 58 Query: 61 GHSEAPK---GPYTIEQLTGDVLGLMDTLKIARANFCGLSMGGLTGVALAARHADRIERV 117 G S P P+ +L DVL +MD I RA+FCGLSMGG+TG+ LAA H +R +R Sbjct: 59 GGSGLPSPAAAPFGFAELGQDVLAIMDHAGIQRAHFCGLSMGGMTGMWLAANHPERFDRF 118 Query: 118 ALCNTAARIGSPEVWVPRAVKARTEGMHALADAVLPRWFTADYMEREPVVLAMIRDVFVH 177 L NTAA IG W R R++GM A+ DAVL RWF+A ++ +A +R + + Sbjct: 119 VLANTAALIGPASGWDTRIQTVRSQGMAAIVDAVLARWFSAAWLAGNAARIAPVRQMLLD 178 Query: 178 TDKEGYASNCEAIDAADLRPEAPGIKVPALVISGTHDLAATPAQGRELAQAIAGARYVEL 237 EGY +NC A+ ADLR + I P LVI+GTHDLA TPAQGRE+AQ IAGARYVEL Sbjct: 179 ASPEGYTANCAAVRDADLRAQLQRIASPVLVIAGTHDLATTPAQGREVAQGIAGARYVEL 238 Query: 238 DASHISNIERADAFTKTVVDFL 259 D +H+SN E+ + F + V FL Sbjct: 239 DGAHLSNWEQPEGFAQAVCGFL 260 Lambda K H 0.320 0.134 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 262 Length adjustment: 25 Effective length of query: 238 Effective length of database: 237 Effective search space: 56406 Effective search space used: 56406 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate RR42_RS21850 RR42_RS21850 (3-oxoadipate enol-lactonase)
to HMM TIGR02427 (pcaD: 3-oxoadipate enol-lactonase (EC 3.1.1.24))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02427.hmm # target sequence database: /tmp/gapView.28307.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02427 [M=251] Accession: TIGR02427 Description: protocat_pcaD: 3-oxoadipate enol-lactonase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-101 322.9 0.3 7.5e-101 322.7 0.3 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS21850 RR42_RS21850 3-oxoadipate enol-l Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS21850 RR42_RS21850 3-oxoadipate enol-lactonase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 322.7 0.3 7.5e-101 7.5e-101 2 250 .. 11 260 .. 10 261 .. 0.98 Alignments for each domain: == domain 1 score: 322.7 bits; conditional E-value: 7.5e-101 TIGR02427 2 lhyrlegaeadkpvlvlinSLGtdlrlwdkvlealtkdfrvlryDkrGHGlSdvpe...gpysiedlad 67 lhy++ega ++pvlv++nSLGtd+++w+++++ l ++frvlryD+rGHG S +p+ +p++ ++l++ lcl|FitnessBrowser__Cup4G11:RR42_RS21850 11 LHYEIEGAP-NAPVLVMSNSLGTDMQMWAPQMDSLLPRFRVLRYDTRGHGGSGLPSpaaAPFGFAELGQ 78 9*******9.******************************************77642227899****** PP TIGR02427 68 dvlallDalgiekaavcGlSlGGliaqaLaarrpdrvealvlsntaakigtaesWeaRiaavraeGlaa 136 dvla++D++gi++a++cGlS+GG+++++Laa++p+r+++ vl+ntaa ig a+ W++Ri++vr++G+aa lcl|FitnessBrowser__Cup4G11:RR42_RS21850 79 DVLAIMDHAGIQRAHFCGLSMGGMTGMWLAANHPERFDRFVLANTAALIGPASGWDTRIQTVRSQGMAA 147 ********************************************************************* PP TIGR02427 137 ladavlerwFtpafreaepaelelvrnmlveqppegYaatcaAirdadlrerleeiavPtlviaGdeDg 205 ++davl+rwF++a+ + ++a+++ vr+ml++++pegY+a+caA+rdadlr++l++ia P+lviaG++D lcl|FitnessBrowser__Cup4G11:RR42_RS21850 148 IVDAVLARWFSAAWLAGNAARIAPVRQMLLDASPEGYTANCAAVRDADLRAQLQRIASPVLVIAGTHDL 216 ********************************************************************* PP TIGR02427 206 stPpelvreiadlvpgarfaeieeaaHlpnleqpeafaallrdfl 250 +t p++ re+a+ ++gar++e++ +aHl+n+eqpe fa+++ +fl lcl|FitnessBrowser__Cup4G11:RR42_RS21850 217 ATTPAQGREVAQGIAGARYVELD-GAHLSNWEQPEGFAQAVCGFL 260 ***********************.********************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (251 nodes) Target sequences: 1 (262 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.17 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory