Align protocatechuate 3,4-dioxygenase (subunit 2/2) (EC 1.13.11.3) (characterized)
to candidate RR42_RS32065 RR42_RS32065 protocatechuate 3,4-dioxygenase
Query= BRENDA::Q0SH27 (237 letters) >FitnessBrowser__Cup4G11:RR42_RS32065 Length = 241 Score = 279 bits (714), Expect = 3e-80 Identities = 130/214 (60%), Positives = 159/214 (74%), Gaps = 1/214 (0%) Query: 20 FPEYKTTRLRSPKNDLILIPQRLGEITGPVFGDADVAKGENDMTHANGGEAQGQRIIVHG 79 F Y +T LRSP L+ + Q L E+TGP+FG V G++D+T + GE G+RI+V G Sbjct: 28 FDPYGSTALRSPNEPLVALNQTLSEVTGPLFGAEFVRNGDSDLTAGHAGEPIGERILVSG 87 Query: 80 RVLDSAGKPIPDTLIEVWQANAGGRYRHKMDSWPAPLDPHFNGVARCLTDKQGHYEFTTI 139 RVLD G+P+P+ LIEVWQANA GRY HK D APLDP+F G R +TD QG Y+F TI Sbjct: 88 RVLDENGRPVPNALIEVWQANAAGRYVHKRDQHDAPLDPNFTGEGRAVTDAQGRYQFKTI 147 Query: 140 KPGAYPWGNHHNAWRPAHIHFSLFGQAFTQRLVTQMYFPDDPFFFQDPIYNSVPEA-ARE 198 KPGAYPW NHHNAWRP HIHFSLFG A+ RLVTQMYFP DP DPI+N VP+A AR+ Sbjct: 148 KPGAYPWRNHHNAWRPQHIHFSLFGNAYATRLVTQMYFPGDPLLAFDPIFNCVPDAKARD 207 Query: 199 RMISTFDYDHTRDNWAVGFKFDIVLRGRDATPFE 232 R++STFD++ T +A+G++FDIVLRGRDATP E Sbjct: 208 RLVSTFDWETTVPEYALGYRFDIVLRGRDATPME 241 Lambda K H 0.322 0.140 0.458 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 241 Length adjustment: 23 Effective length of query: 214 Effective length of database: 218 Effective search space: 46652 Effective search space used: 46652 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory