Align protocatechuate 3,4-dioxygenase (subunit 2/2) (EC 1.13.11.3) (characterized)
to candidate RR42_RS32060 RR42_RS32060 protocatechuate 3,4-dioxygenase
Query= BRENDA::A0A193DXA9 (206 letters) >FitnessBrowser__Cup4G11:RR42_RS32060 Length = 192 Score = 149 bits (377), Expect = 2e-41 Identities = 88/200 (44%), Positives = 118/200 (59%), Gaps = 16/200 (8%) Query: 11 TASQTAGPYVHIGCTPNFVGIEGVFEKDLGSGPLYNDKARGERISVRGTVYDGAGMPLKD 70 TASQT GPY+HIG + G+ DL + + GERI + G V DG G P+ D Sbjct: 5 TASQTVGPYLHIG-------LSGLDRADLTAEA---SELTGERIVIEGRVIDGKGDPVPD 54 Query: 71 ALIEIWQADTDGYYNSPSETRGKAD----PNFIGWGRSPGDMDTGEFVFETIKPGSVPFR 126 ++EIWQA+ G Y P + R A+ P F G+GR P D G F F T+KPG VP Sbjct: 55 GMVEIWQANPAGRYRHPDDARDGAETALVPGFTGFGRLPTGPD-GSFRFVTVKPGPVPGP 113 Query: 127 DGRPMAPHITFWIVARGINIGLQTRMYFPEEQEANAADPVLARIEQKSRIATLVAKKEEG 186 DG+P APHI + RG+ L TR+YFP+E +ANA D VL+++ +R TLVA++ Sbjct: 114 DGQPQAPHIVVSLFMRGLLKHLSTRLYFPDEAQANARDWVLSQV-PAARRHTLVAQQAGA 172 Query: 187 NVYRFDIRLQGEGETVFFDI 206 ++ + LQG+ ETVFFDI Sbjct: 173 GRLQWQVVLQGQDETVFFDI 192 Lambda K H 0.318 0.139 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 206 Length of database: 192 Length adjustment: 21 Effective length of query: 185 Effective length of database: 171 Effective search space: 31635 Effective search space used: 31635 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory