GapMind for catabolism of small carbon sources

 

Alignments for a candidate for pcaH in Cupriavidus basilensis 4G11

Align protocatechuate 3,4-dioxygenase type II α subunit (EC 1.13.11.3) (characterized)
to candidate RR42_RS32065 RR42_RS32065 protocatechuate 3,4-dioxygenase

Query= metacyc::MONOMER-14209
         (195 letters)



>FitnessBrowser__Cup4G11:RR42_RS32065
          Length = 241

 Score = 88.6 bits (218), Expect = 8e-23
 Identities = 48/132 (36%), Positives = 72/132 (54%), Gaps = 6/132 (4%)

Query: 45  GKHITLRGTVLDGDGLPVPDALIEIWQPDGLGRF---SGHHPLLKTAEFKGFGRAMCDAL 101
           G+ I + G VLD +G PVP+ALIE+WQ +  GR+      H       F G GRA+ DA 
Sbjct: 80  GERILVSGRVLDENGRPVPNALIEVWQANAAGRYVHKRDQHDAPLDPNFTGEGRAVTDAQ 139

Query: 102 GLFSFETVKPGGAPMRD--GVIQAPHVAVSIFGKGLNRHLYTRVYFDDEEANKSDPVLNS 159
           G + F+T+KPG  P R+     +  H+  S+FG      L T++YF  +     DP+ N 
Sbjct: 140 GRYQFKTIKPGAYPWRNHHNAWRPQHIHFSLFGNAYATRLVTQMYFPGDPLLAFDPIFNC 199

Query: 160 IPE-DLRSKLIA 170
           +P+   R +L++
Sbjct: 200 VPDAKARDRLVS 211


Lambda     K      H
   0.320    0.140    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 143
Number of extensions: 7
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 195
Length of database: 241
Length adjustment: 22
Effective length of query: 173
Effective length of database: 219
Effective search space:    37887
Effective search space used:    37887
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory