Align ABC transporter for D-Alanine, ATPase component (characterized)
to candidate RR42_RS16370 RR42_RS16370 glutamine ABC transporter ATP-binding protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_5405 (254 letters) >FitnessBrowser__Cup4G11:RR42_RS16370 Length = 260 Score = 345 bits (886), Expect = e-100 Identities = 166/252 (65%), Positives = 209/252 (82%), Gaps = 4/252 (1%) Query: 3 EAIKQPVSPEGIIQMQGVNKWYGQFHVLKDINLNVKQGERIVLCGPSGSGKSTTIRCLNR 62 +A QP + I+++ V+KW+G+ VL +I++ V++GERIV+CGPSGSGKST IRC+NR Sbjct: 12 DAASQPAT----IELRRVSKWFGETQVLSNIDMRVQRGERIVICGPSGSGKSTMIRCINR 67 Query: 63 LEEHQQGRIVVDGVELTNDLKQIEAIRREVGMVFQHFNLFPHLTILQNCTLAPMWVRKMP 122 LEEHQQG I+V+GV LT + I +RREVGMVFQ FNLFPHL++LQN +APM +R + Sbjct: 68 LEEHQQGEILVEGVSLTKSPRNISFVRREVGMVFQQFNLFPHLSVLQNLMIAPMKIRGIK 127 Query: 123 KRKAEEIAMHYLERVRIPEQAHKYPGQLSGGQQQRVAIARALCMKPKIMLFDEPTSALDP 182 K++AEE A H+LERVRI ++A +YP QLSGGQQQRVAIARALCMKPK+MLFDEPTSALDP Sbjct: 128 KKEAEETARHFLERVRIGDKADRYPAQLSGGQQQRVAIARALCMKPKMMLFDEPTSALDP 187 Query: 183 EMVKEVLDTMIGLAEDGMTMLCVTHEMGFARTVANRVIFMDKGEIVEQAAPNDFFDNPQN 242 EM+KEVLD M+ LA DGMTM+CVTHEMGFARTVA+R++FMDKGEIVE+A P FF P++ Sbjct: 188 EMIKEVLDVMMQLARDGMTMVCVTHEMGFARTVADRILFMDKGEIVEEAQPEAFFSMPKS 247 Query: 243 DRTKLFLSQILH 254 +R + FL QIL+ Sbjct: 248 ERARAFLGQILN 259 Lambda K H 0.322 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 260 Length adjustment: 24 Effective length of query: 230 Effective length of database: 236 Effective search space: 54280 Effective search space used: 54280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory