Align D-alanine dehydrogenase (EC 1.4.99.-) (characterized)
to candidate RR42_RS09075 RR42_RS09075 amino acid dehydrogenase
Query= reanno::azobra:AZOBR_RS08020 (436 letters) >FitnessBrowser__Cup4G11:RR42_RS09075 Length = 432 Score = 363 bits (931), Expect = e-105 Identities = 192/433 (44%), Positives = 257/433 (59%), Gaps = 21/433 (4%) Query: 1 MRVIVLGSGVIGVSTAYFLAKAGHEVTVVDRQPGPALETSYANAGEVSPGYSAPWAAPGL 60 M VIV+G+GVIGV +A++L +AG +VTVV+R+ PA E+S+ NAG ++PGY PWAAPG+ Sbjct: 1 MHVIVIGAGVIGVCSAWYLREAGFDVTVVERRAAPAQESSFGNAGVIAPGYVTPWAAPGM 60 Query: 61 MAKAVKWMLMKHSPLVIRPKMDPAMWSWCLKLLANANERSYEINKGRMVRLAEYSRDCLR 120 K ++ + SP++ RP DPAMW W + L Y +NK RM RLA YSR CL Sbjct: 61 PGKVLRNLFASTSPVLFRPSADPAMWRWIARWLGECTLERYRLNKLRMQRLAFYSRQCLH 120 Query: 121 VLRDETGIRYDERAKGTLQVFRTQKQVDAAATDMAVLDRFKVPYSLLDVEGCAAVEPALR 180 LR + I Y E+++G LQ+FRTQ+ D A +A+L KV + L+D +GC +EP L Sbjct: 121 ALRGQLQIDY-EQSQGYLQLFRTQRDRDLAEPALALLREHKVAHRLVDADGCRRIEPGLT 179 Query: 181 LVKEKIVGGLLLPGDETGDCFRFTNALAAMATELGVEFRYNTGIRKLE------------ 228 + GGL LP DE+G+C F L +A GV F ++ L Sbjct: 180 -TDTPLAGGLHLPEDESGNCPMFVRRLRVLAEAAGVRFVMDSDASALRPLPGGKLSLDLR 238 Query: 229 ----SDGRRVTGVVTDAGTLTADSYVVAMGSYSPTLVKPFGLDLPVYPVKGYSLTLPIVD 284 D R GV TLTAD +V+ G S L++P GL +P+YPVKGYS T+ + D Sbjct: 239 STAAGDARSARGV---RETLTADRVLVSAGIASAALLRPLGLRIPLYPVKGYSATVHVSD 295 Query: 285 AAGAPESTVMDETHKIAVTRLGDRIRVGGTAELTGFDLTLRPGRRGPLDHVVSDLFPTGG 344 AP +MDE++K+A+TR+G+R+R+ GTAEL L LRP L V D FP G Sbjct: 296 ELQAPLGALMDESYKVAITRMGNRLRIAGTAELGSRKLDLRPAAINTLLKVARDWFPVAG 355 Query: 345 DLSKAEFWTGLRPNTPDGTPIVGPTPVRNLFLNTGHGTLGWTMAAGSGRVVADVVGGRQT 404 A W G RP PDG P++G T V L+LN GHG+ GW MA GSGR+ AD++ G + Sbjct: 356 HYGTATLWAGARPMLPDGPPLIGATAVPGLYLNLGHGSTGWAMACGSGRIAADLIAGNRP 415 Query: 405 EIDMDGLTVARYG 417 ID+DGLT RYG Sbjct: 416 GIDLDGLTPDRYG 428 Lambda K H 0.319 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 577 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 432 Length adjustment: 32 Effective length of query: 404 Effective length of database: 400 Effective search space: 161600 Effective search space used: 161600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory