Align D-alanine dehydrogenase (EC 1.4.99.-) (characterized)
to candidate RR42_RS25930 RR42_RS25930 amino acid dehydrogenase
Query= reanno::azobra:AZOBR_RS08020 (436 letters) >FitnessBrowser__Cup4G11:RR42_RS25930 Length = 422 Score = 223 bits (567), Expect = 1e-62 Identities = 143/404 (35%), Positives = 208/404 (51%), Gaps = 13/404 (3%) Query: 3 VIVLGSGVIGVSTAYFLAKAGHEVTVVDRQPGPALETSYANAGEVSPGYSAPWAAPGLMA 62 + V+G G+ GV+TAY LAK G VT++++ A+ETS+AN G++S + W + Sbjct: 4 IAVIGGGITGVTTAYALAKRGFSVTLLEKHRYAAMETSFANGGQLSASNAEVWTHWSTIL 63 Query: 63 KAVKWMLMKHSPLVIRPKMDPAMWSWCLKLLANANERSYEINKGRMVRLAEYSRDCLRVL 122 K +KWML +PL++ P+ SW + +A Y N RLA +RD L Sbjct: 64 KGIKWMLKSDAPLLVNPRPSWHKLSWFAEFIAAIPH--YRKNTIETTRLAIAARDHLFSW 121 Query: 123 RDETGIRYDERAKGTLQVFRTQKQVDAAATDMAVLDRFKVPYSLLDVEGCAAVEPALRLV 182 GI +D + +G L ++R + + A +L + + E A+EP L Sbjct: 122 AAAEGIDFDLKKEGILHIYRDKAGFEHAGRVSKLLAEGGLARHAVTPEEMRAIEPTL--- 178 Query: 183 KEKIVGGLLLPGDETGDCFRFTNALAAMATELGVEFRYNTGIRKLESDGRRVTGVVTD-- 240 + GG D TGD +FT+ +AA LGV YN ++ + +DGR+VT V D Sbjct: 179 AGQYYGGYFTQSDSTGDIHKFTSGMAAAIDRLGVRCLYNQDVQSVSTDGRQVTIVSGDGR 238 Query: 241 -AGTLTADSYVVAMGSYSPTLVKPFGLDLPVYPVKGYSLTLPIVDA---AGAPESTVMDE 296 A + D VV G+ S L G + +YPVKGYS+T+ + DA A AP +++D+ Sbjct: 239 QAESRVFDGVVVCAGTASRALAASLGDRVNIYPVKGYSITVNLNDAQSQAAAPVVSLLDD 298 Query: 297 THKIAVTRLG-DRIRVGGTAELTGFDLTLRPGRRGPLDHVVSDLFPTGGDLSKAEFWTGL 355 K+ +RLG DR RV GTAE G++ +R R PL V+ FP G W GL Sbjct: 299 ETKLVTSRLGVDRFRVAGTAEFNGYNRDIRADRIRPLVEWVNQCFP-GVSTRSVVPWAGL 357 Query: 356 RPNTPDGTPIVGPTPVRNLFLNTGHGTLGWTMAAGSGRVVADVV 399 RP P P VG +F NTGHG LGWT++A + ++ DVV Sbjct: 358 RPMMPTMLPRVGRGRASCVFYNTGHGHLGWTLSAVTADMIGDVV 401 Lambda K H 0.319 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 22 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 422 Length adjustment: 32 Effective length of query: 404 Effective length of database: 390 Effective search space: 157560 Effective search space used: 157560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory