Align D-lactate transporter, permease component 2 (characterized)
to candidate RR42_RS16975 RR42_RS16975 ABC transporter permease
Query= reanno::Phaeo:GFF1250 (340 letters) >FitnessBrowser__Cup4G11:RR42_RS16975 Length = 311 Score = 155 bits (393), Expect = 1e-42 Identities = 109/345 (31%), Positives = 176/345 (51%), Gaps = 49/345 (14%) Query: 1 MDAILLQILNGLDKGSAYALIALGLTLIFGTLGVVNFAHGALFMIGAFCAVTVQRVLSLS 60 MD + QI+NGL GS YALIALG T+++G LG++NFAHG + MIGA A++ +L L Sbjct: 1 MDIFIQQIVNGLVLGSIYALIALGYTMVYGILGIINFAHGDVLMIGALTALSA--ILGL- 57 Query: 61 FETVDETQKDFLGNPLKVKTPYVESWFGPEVGGAIIDWAVPLAILFAIPIMIGVGYVMER 120 QK F G P W + +A L A+P+ + Y +ER Sbjct: 58 -------QKFFPGLP---------EWL-----------TLVIATLIAMPVCAALAYTIER 90 Query: 121 GLIKHFYKRPHADQILVTFGLAIVLQEVVKYFYGANPIQTP--APDALNGVVNLG-SIIG 177 + P ++ G++I+LQ + + NP+ P P + + + G +I G Sbjct: 91 VAYRPLRNAPRLAPLITAIGVSIILQTLAMMIWSRNPLTFPQLLPSSPIDIGSTGATITG 150 Query: 178 MDIVYPVWRVVYFFFAVVIIGGIFSFLQFTTFGMVVRAGMADRETVGLLGINIDRRFTIM 237 +I V A++++ G+ + + T G +RA +++ GL+G+N + + Sbjct: 151 KEI-------VIIGMALMVMAGLLTLVNRTKLGRAMRATAENQKVAGLMGVNPNFVISAT 203 Query: 238 FGIAAAVAGLAGVMYTPINSPNYHMGMDFL--VLSFVVVVVGGMGSLPGAVLAGFLLGVL 295 F I AA+A LAGVM N N H M F+ + +F V+GG+G+L GA++ G LLG++ Sbjct: 204 FMIGAALAALAGVMMA-TNYGNAHFYMGFIPGLKAFTAAVLGGIGNLAGAMVGGMLLGLI 262 Query: 296 ESFASMNEIKSLIPGI-----DQIIIYVVAIIILLTRPRGLMGRK 335 E+ + I L G+ + ++V II+L+ RP G+MG + Sbjct: 263 EALGA-GYIGDLTNGVFGSNYQDVFAFIVLIIVLVFRPSGIMGER 306 Lambda K H 0.329 0.147 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 311 Length adjustment: 28 Effective length of query: 312 Effective length of database: 283 Effective search space: 88296 Effective search space used: 88296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory