Align D-lactate oxidase, FAD-linked subunit (EC 1.1.3.15) (characterized)
to candidate RR42_RS26635 RR42_RS26635 2-hydroxyacid dehydrogenase
Query= reanno::Smeli:SMc00832 (479 letters) >FitnessBrowser__Cup4G11:RR42_RS26635 Length = 466 Score = 203 bits (516), Expect = 1e-56 Identities = 147/461 (31%), Positives = 225/461 (48%), Gaps = 25/461 (5%) Query: 32 GGLISDERGLKPFETDAFIAYRRMPLAVVLPETTEHVAAVLKYCSRYGIPIVPRGAGTSL 91 G +S + + + TD YR VV+P TTE V+ V+ +C + +P+VP+G TSL Sbjct: 8 GACLSGDADTESYVTDYRRIYRGKAQVVVMPSTTEQVSQVMAWCHAHDVPVVPQGGNTSL 67 Query: 92 SGGAIPQED--AIVVGLSKMSRTLDIDLFNRTATVQAGVTNLNISDAVSADGFFYAPDPS 149 GGA+P + A+++ L +M+R L +D N T TVQAGVT A + +A Sbjct: 68 MGGAVPDDSGTAVLLSLGRMNRVLAVDTINDTMTVQAGVTLNAARTAAEQEQRLFALRIG 127 Query: 150 SQLACTIGGNIGMNSGGAHCLKYGVTTNNLLGVKMVLFDGTVI-ELGGKALDAPGYDLLG 208 S+ +C IGGN+ N+GG L+YG + +LG++ VL DG + L G D GYDL Sbjct: 128 SEGSCQIGGNLATNAGGTAVLRYGNMRDLVLGIEAVLPDGRIYSSLRGLRKDNTGYDLKQ 187 Query: 209 LVCGSEGQLGIVTEATVRLIAKPEGARPVLFGFASSESAGSCVADII--GSGIIPVAIEF 266 L GSEG LGI+T A ++L+ +P A V F S A + + G A E Sbjct: 188 LFVGSEGTLGIITAAVLKLMPQPR-ANAVAFVAVQSPEAAVRLLGVAKQHGGQAVTAFEL 246 Query: 267 MDRPAIE-ICEAFAQAGYPLDVEALLIVEVE----GSEAEMDATLAGIIEIA-RRHGVMT 320 + PA+E + E PL +V +E GS+ ++ATL I+E + V+ Sbjct: 247 ISAPALELVLEYLGDVTSPLPARHDWMVLIELTSGGSDESLNATLMEILEAGLAQELVLD 306 Query: 321 IRESQSALEAALIWKGRKSAFGATGRIADYICMDGTVPLSQLSHVLRRTGEIVAGY--GL 378 + S +A W+ R+ A R I D +VPLS+++ + V Sbjct: 307 AAVAASLADAQRFWRIREEISDAQTRTGGSIKCDVSVPLSRIAAFIGDASAKVLALEPAA 366 Query: 379 RVANVFHAGDGNMHPLILYNINDPEEAARAEAAG-------NDILKLCVEAGGCLTGEHG 431 R+ H GDGN+H +N P++ + A+ G + L G ++ EHG Sbjct: 367 RMVIYGHMGDGNVH----FNPLRPKDRSAADFLGQWYAPISEAVDTLAHAENGSISAEHG 422 Query: 432 VGIEKRDLMLHQYSRADLGQQMAARAAFDPQWLMNPSKVFP 472 +G+ KRD + S +L + A DP+ L+NP+K+ P Sbjct: 423 IGVAKRDDLKRYKSPVELELMWQVKRALDPKNLLNPAKMLP 463 Lambda K H 0.320 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 551 Number of extensions: 35 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 479 Length of database: 466 Length adjustment: 33 Effective length of query: 446 Effective length of database: 433 Effective search space: 193118 Effective search space used: 193118 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory