GapMind for catabolism of small carbon sources

 

Aligments for a candidate for glcE in Cupriavidus basilensis 4G11

Align D-lactate oxidase, FAD binding subunit (EC 1.1.3.15) (characterized)
to candidate RR42_RS29880 RR42_RS29880 glycolate oxidase

Query= reanno::Cup4G11:RR42_RS17310
         (374 letters)



>lcl|FitnessBrowser__Cup4G11:RR42_RS29880 RR42_RS29880 glycolate
           oxidase
          Length = 357

 Score =  358 bits (919), Expect = e-103
 Identities = 194/358 (54%), Positives = 240/358 (67%), Gaps = 13/358 (3%)

Query: 17  DAIRHATGTRTPLRLRGGGSKDFYGQHPQGTLLDTRAYSGIVDYDPPELVITARCGTPLA 76
           + + HA  T+T L + GGG+K FYG+ P G   D R  SGI  Y+P ELV+TAR GTPL 
Sbjct: 13  ETVLHARKTKTSLNIVGGGTKCFYGEEPSGEPCDVRRLSGICSYEPSELVVTARAGTPLE 72

Query: 77  QIEAALAERRQMLAFEPPHFSTGADGSDVATIGGAVAAGLSGPRRQAVGALRDFVLGTRV 136
           ++EA LAE  Q LAFEPP F+ G+      T+GGAVAAGLSGP R  VG++RDFVLG  +
Sbjct: 73  ELEAVLAEHNQYLAFEPPRFAKGS------TVGGAVAAGLSGPARVGVGSIRDFVLGATM 126

Query: 137 MDGRGDVLSFGGQVMKNVAGYDVSRLMSGSLGTLGLILEVSLKVLPVPFDDATLRFALDE 196
           ++G+G++L+FGGQVMKNVAGYDVSRL++GS+G LG+I EVSLKVLP+     TL    DE
Sbjct: 127 INGKGELLTFGGQVMKNVAGYDVSRLLAGSMGILGVICEVSLKVLPIHSSRITLFIERDE 186

Query: 197 AAALDRLNDWGGQPLPIAASAWHDGVLHLRLSGAAAALRAARARLGGEAVDAAQADALWR 256
           A AL  LN    Q LP+ ASAWHDG L LRLSGAA+A+  AR RLGG  ++  +A + W 
Sbjct: 187 AGALSLLNGLTRQALPVNASAWHDGKLFLRLSGAASAVTEARKRLGGTELEPDEALSWWD 246

Query: 257 ALREHSHAFFAPVQAGRALWRIAVPTTAAPLALPGGQLIEWGGGQRWWLGGSDSAADSAI 316
           A+R+H H FF+  Q+   LWR++VP  + P  L   QLIEWGG  R WL   D   D   
Sbjct: 247 AVRDHRHDFFS--QSDAPLWRVSVPAVSQPF-LAANQLIEWGGALR-WLYTDDPIED--- 299

Query: 317 VRAAAKAAGGHATLFRNGDKAVGVFTPLSAPVAAIHQRLKATFDPAGIFNPQRMYAGL 374
           VR  A + GGHATLFR+     GVFTP S  +  IH+ LK  FDP GIFN  R+Y GL
Sbjct: 300 VREMASSLGGHATLFRDPHHRSGVFTPPSDALFEIHRNLKQAFDPDGIFNVGRLYPGL 357


Lambda     K      H
   0.321    0.136    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 373
Number of extensions: 17
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 374
Length of database: 357
Length adjustment: 30
Effective length of query: 344
Effective length of database: 327
Effective search space:   112488
Effective search space used:   112488
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory