Align lactate dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.110) (characterized)
to candidate RR42_RS26635 RR42_RS26635 2-hydroxyacid dehydrogenase
Query= BRENDA::H6LBS1 (466 letters) >FitnessBrowser__Cup4G11:RR42_RS26635 Length = 466 Score = 201 bits (512), Expect = 3e-56 Identities = 148/434 (34%), Positives = 217/434 (50%), Gaps = 21/434 (4%) Query: 46 EVLIKVTSTEEVSKIMKYAYEHNIPVVVRGSGTGLVGACVPLFGG--IMLETTLMNNILE 103 +V++ ++TE+VS++M + + H++PVV +G T L+G VP G ++L MN +L Sbjct: 33 QVVVMPSTTEQVSQVMAWCHAHDVPVVPQGGNTSLMGGAVPDDSGTAVLLSLGRMNRVLA 92 Query: 104 LDTENLTVTVEPGVLLMELSKFVE-ENDLFYPPDPGEKSATIAGNISTNAGGMRAVKYGV 162 +DT N T+TV+ GV L E E LF E S I GN++TNAGG ++YG Sbjct: 93 VDTINDTMTVQAGVTLNAARTAAEQEQRLFALRIGSEGSCQIGGNLATNAGGTAVLRYGN 152 Query: 163 TRDYVRGLTVVLANGEIIELGGKIVKNSSGYSLKDLVIGSEGTLCVITKAILKLLPLPKM 222 RD V G+ VL +G I + K+++GY LK L +GSEGTL +IT A+LKL+P P+ Sbjct: 153 MRDLVLGIEAVLPDGRIYSSLRGLRKDNTGYDLKQLFVGSEGTLGIITAAVLKLMPQPRA 212 Query: 223 TLSLLIPFENISDAAGI--VPKIIKSKAIPTAIEFMERQTILFAEDFLG---KKFPDSSS 277 + ++ A + V K +A+ TA E + + ++LG P Sbjct: 213 NAVAFVAVQSPEAAVRLLGVAKQHGGQAV-TAFELISAPALELVLEYLGDVTSPLPARHD 271 Query: 278 NAYILLTFDGNTKEQVEAEYETVANLCLA-EGAKDVYIVDTVERKDSVWSARGAFLEAIK 336 ++ G + E + A + LA E D + ++ W R +A + Sbjct: 272 WMVLIELTSGGSDESLNATLMEILEAGLAQELVLDAAVAASLADAQRFWRIREEISDA-Q 330 Query: 337 ASTTEMDECDVVVPRNRIAEFI--EFTHDLAKEMDVRIPSFGHAGDGNLHIYVCRDELCQ 394 T +CDV VP +RIA FI LA E R+ +GH GDGN+H R + Sbjct: 331 TRTGGSIKCDVSVPLSRIAAFIGDASAKVLALEPAARMVIYGHMGDGNVHFNPLRPKDRS 390 Query: 395 A-----DWEAKLAEAMDRMYAKALTFEGLVSGEHGIGYAKRKYLLNDFGTEHLALMAGIK 449 A W A ++EA+D + A G +S EHGIG AKR L L LM +K Sbjct: 391 AADFLGQWYAPISEAVDTL---AHAENGSISAEHGIGVAKRDDLKRYKSPVELELMWQVK 447 Query: 450 QTFDPKNLLNPKKV 463 + DPKNLLNP K+ Sbjct: 448 RALDPKNLLNPAKM 461 Lambda K H 0.318 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 429 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 466 Length of database: 466 Length adjustment: 33 Effective length of query: 433 Effective length of database: 433 Effective search space: 187489 Effective search space used: 187489 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory