GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lctP in Cupriavidus basilensis 4G11

Align L-lactate and D-lactate permease (lctP family) (characterized)
to candidate RR42_RS14610 RR42_RS14610 lactate permease

Query= reanno::pseudo5_N2C3_1:AO356_07550
         (564 letters)



>lcl|FitnessBrowser__Cup4G11:RR42_RS14610 RR42_RS14610 lactate
           permease
          Length = 558

 Score =  502 bits (1292), Expect = e-146
 Identities = 265/565 (46%), Positives = 361/565 (63%), Gaps = 12/565 (2%)

Query: 4   WQQLYSPLGSLGLSALAAVIPIVFFFLALAVFRLKGHVAGSITLALAIAVAIFAFNMPAD 63
           W Q+Y PLGSL LS LAA IP+     ALA F L+ H+A  + L + + +A   F MPA 
Sbjct: 2   WTQVYDPLGSLALSTLAAGIPVAVLLAALAFFHLQAHLAAGLALVVGVVIASAVFGMPAA 61

Query: 64  MAFAAAGYGFAYGLWPIAWIIVAAVFLYKLTVKSGQFEVIRSSVLSITDDQRLQVLLIGF 123
           MA  AAG G A GL+PI WI++  +FL++LT  +G F+V+++S+  IT+D+RLQ+LL+ F
Sbjct: 62  MAGKAAGLGIASGLFPIGWIVLNIIFLHRLTTINGSFKVLQNSISGITEDRRLQLLLVAF 121

Query: 124 CFGAFLEGAAGFGAPVAITAALLVGLGFNPLYAAGLCLIANTAPVAFGALGIPIIVAGQV 183
            FGAF EGAAGFG PVA+T A+L+GLGF+PL A+GL LIANTAPVAFGALG P+I    V
Sbjct: 122 SFGAFFEGAAGFGTPVAVTGAILIGLGFSPLAASGLALIANTAPVAFGALGAPLIGLSAV 181

Query: 184 TGIDAFKIGAMTGRQLPLLSLFVPFWLVFMMDGLRGVRETWPAALVAGLSFAITQYFTSN 243
           TG+D   + AM GRQLP  SL VPFWL++   GLRG+   WPA LVAG++FA+ Q+  SN
Sbjct: 182 TGLDLLHLSAMVGRQLPFFSLLVPFWLIWAFAGLRGMLAIWPAILVAGVTFAVPQFLVSN 241

Query: 244 FIGPELPDITSALASLISLTLFLKVWQPKRT-AGAQIAGATSSATVTASVGGFGQPRSTV 302
           + GP L D+ +AL S+  LTLFLKVW+PK      +I G    + V        + R++ 
Sbjct: 242 YHGPWLVDVIAALVSMGCLTLFLKVWKPKEIWTSTRILGRRDDSKVDDPEAVAAEARASA 301

Query: 303 ASPYSLGEIIKAWSPFLILTVLVTIWTLKPFKAMFAAGGSMYG-WVFNFAIPHLDQMVIK 361
           AS      ++KAW P++ILTV V +W +  FK +      M G W + F IP LD+ V K
Sbjct: 302 ASAGI--SVVKAWMPWVILTVFVFVWGVPEFKKL------MDGLWQWKFPIPGLDKAVFK 353

Query: 362 VAPIVINPTAIPAVFKLDPISATGTAIFFSALISMLVLKINIKTGLTTFKETLFELRWPI 421
           V P+V   TA  AVF  + +S  GT I  S ++  L++  ++   +  + ET+  +++ +
Sbjct: 354 VPPVVPKATAEGAVFTFNVLSMAGTGILVSGILGGLLMGYSLPRLVREYWETIKLVKYSL 413

Query: 422 LSIGMVLAFAFVTNYSGMSSTMALVLAGTGAAFPFFSPFLGWLGVFLTGSDTSSNALFSS 481
           L+I  +    ++T YSG+ +T+ L  A TG  +P F   LGWLGV LTGSDT+SN LF  
Sbjct: 414 LTICAMFGVGYLTRYSGLDATLGLAFAHTGVLYPLFGTMLGWLGVALTGSDTASNVLFGG 473

Query: 482 LQATTAHQIGVNDTLLVAANTSGGVTGKMISPQSIAVACAATGLVGKESDLFRFTLKHSL 541
           LQ TTA Q+G++  L+ +AN+SGGV GKMI  QSI VA  AT   G E ++ R+   HS+
Sbjct: 474 LQKTTAEQLGLSPILMASANSSGGVMGKMIDAQSIVVASTATKWYGHEGEILRYVFFHSI 533

Query: 542 FFATIVGLITLAQAYW--FTGMLVH 564
             A +VGL    QAY   FT M++H
Sbjct: 534 ALAILVGLFITLQAYVHPFTQMVIH 558


Lambda     K      H
   0.327    0.139    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 882
Number of extensions: 52
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 564
Length of database: 558
Length adjustment: 36
Effective length of query: 528
Effective length of database: 522
Effective search space:   275616
Effective search space used:   275616
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory