Align D-serine transporter DsdX; D-serine-specific permease (characterized)
to candidate RR42_RS28835 RR42_RS28835 permease DsdX
Query= SwissProt::A0A0H2VAP9 (445 letters) >FitnessBrowser__Cup4G11:RR42_RS28835 Length = 453 Score = 324 bits (830), Expect = 4e-93 Identities = 175/445 (39%), Positives = 264/445 (59%), Gaps = 16/445 (3%) Query: 12 LISIVLIVLTIVKFKFHPFLALLLASFFVGTMMGMGPLDMVNAIESGIGGTLGFLAAVIG 71 LI+++ +V+ I KFK +PF+ L++ S +G +GM D+V + E+G+GGTLG +A V+G Sbjct: 14 LIAVIALVVLIAKFKLNPFITLVVVSVLLGFAVGMPMGDIVKSFEAGVGGTLGHIALVVG 73 Query: 72 LGTILGKMMEVSGAAERIGLTL------QRCRWLSADVIMVLVGLICGITLFVEVGVVLL 125 LGT+LGKMM SG AERI TL + W MV + I G+ +F EVG VLL Sbjct: 74 LGTMLGKMMAESGGAERIARTLIDAFGEKNVHWA-----MVTIAFIVGLPVFFEVGFVLL 128 Query: 126 IPLAFSIAKKTNTSLLKLAIPLCTALMAVHCVVPPHPAALYVANKLGADIGSVIVYGLLV 185 +P+AF++AK+T TS++ + IP+ L VH ++PPHPAAL ADIG I+Y L+V Sbjct: 129 VPIAFNVAKRTGTSMVLVGIPMVAGLSVVHGLIPPHPAALLAVTAYKADIGKTILYALIV 188 Query: 186 GLMASLIGGPLFLKFLGQRLPF---KPVPTEFA--DLKVRDEKTLPSLGATLFTVLLPIA 240 G+ + I GPLF K + + + P+ +F D V+ LP G TLFT+LLP+ Sbjct: 189 GIPTAAIAGPLFAKLMTRYVTLPDVNPLAAQFTEEDEGVKASHELPGFGITLFTILLPVI 248 Query: 241 LMLVKTIAELNMARESGLYTLLEFIGNPITATFIAVFVAYYVLGIRQHMSMGTMLTHTEN 300 LML+ + A+L ++ L+ IGN + A IA V++Y G R+ + +L T Sbjct: 249 LMLIGSWADLITTPKTFANDFLKLIGNSVIALLIAALVSFYTFGKRRGFTRENILRFTNE 308 Query: 301 GFGSIANILLIIGAGGAFNAILKSSSLADTLAVILSNMHMHPILLAWLVALILHAAVGSA 360 A I L++GAGG F +L+ S +++ + + + H+ +LL WLVA+++ A GSA Sbjct: 309 CVAPTAIITLVVGAGGGFGRVLRDSGISNAIVDVATGAHVSVLLLGWLVAVLIRIATGSA 368 Query: 361 TVAMMGATAIVAPMLPLYPDISPEIIAIAIGSGAIGCTIVTDSLFWLVKQYCGATLNETF 420 TVAM A IVAP+ P PE++ + G+G++ + V D FWLVK+Y T+ +TF Sbjct: 369 TVAMTTAAGIVAPIAASVPGTRPELLVLTTGAGSLILSHVNDGGFWLVKEYFNMTVAQTF 428 Query: 421 KYYTTATFIASVIALAGTFLLSFII 445 K ++ + SVIAL T L+ ++ Sbjct: 429 KTWSVCETLISVIALLLTLALATVV 453 Lambda K H 0.328 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 553 Number of extensions: 33 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 453 Length adjustment: 33 Effective length of query: 412 Effective length of database: 420 Effective search space: 173040 Effective search space used: 173040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory