GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pta in Cupriavidus basilensis 4G11

Align Phosphate acetyltransferase; EC 2.3.1.8; Phosphotransacetylase (uncharacterized)
to candidate RR42_RS05210 RR42_RS05210 malic enzyme

Query= curated2:Q726S7
         (704 letters)



>lcl|FitnessBrowser__Cup4G11:RR42_RS05210 RR42_RS05210 malic enzyme
          Length = 773

 Score =  174 bits (442), Expect = 1e-47
 Identities = 112/338 (33%), Positives = 171/338 (50%), Gaps = 10/338 (2%)

Query: 372 RITPKMFEFNLIEK-----AKRNRMRIVLPEGAEERILRAADILVRREVADIILLGDANT 426
           ++T  ++   LI K     AK    R+V  EG EER+LRA   +V   +A  IL+G  + 
Sbjct: 434 QLTQYVYHTGLIMKPVFTAAKAAPKRVVYAEGEEERVLRAVQTVVDEGLARPILIGRPHV 493

Query: 427 VGSRIGDLGLDMDG---VQIVQPNLSPKFDEYVAAYHECRKKKGISMEQARDMMN-DPTY 482
           +  RI   GL +      +++ P   P++  Y  AYH  R + G++ + A+ M+    T 
Sbjct: 494 IQMRIDKAGLRLKAGADFELINPEDDPRYRAYHEAYHTLRGRDGVTPDVAKVMLRRSNTL 553

Query: 483 FGTMMVHKGDADGMVSGAINTTAHTIRPAFEFIKTKPGVSIVSSVFLMCLKDRVLVFGDC 542
            GTM++H GDAD M+ G +      +    + I   PG  + +++  + L+   L   D 
Sbjct: 554 IGTMLMHMGDADAMLCGTVGRFEAHLEHVRDVIGMAPGAKVFAAMNALMLEKYTLFITDT 613

Query: 543 AVNPNPTAEQLAEIAISASHTARIFGVDPRVAMLSYSTGSSGKGADVEKVIEATRIAKER 602
            VN +PTAE+LA I   A+     FG  P+VA++S+S   S       K+  A  I    
Sbjct: 614 FVNDDPTAEELAAITQLAAEEIARFGQHPKVALMSHSMFGSSDRPSARKMRAAQEILARE 673

Query: 603 APELLLEGPLQYDAAIDMDVARTKLPGSTVAGQATVFIFPDLNTGNNTYKAVQRAAG-AV 661
           AP L +EG +Q DAA+  DV R  LPG+ +AG A + + P L+  N  +  ++   G  V
Sbjct: 674 APHLEVEGEMQGDAALVEDVRRHFLPGTKLAGSANLLVMPTLDAANIAFNLLKITGGQGV 733

Query: 662 AIGPVLQGLNKPVNDLSRGCTVADIVNTVAITAIQAQA 699
            IGP+L G  KPV+ L+   T   IVN  A+   +A A
Sbjct: 734 TIGPILLGAAKPVHILNPQATTRRIVNMTAVAVAEANA 771


Lambda     K      H
   0.319    0.135    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1179
Number of extensions: 64
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 704
Length of database: 773
Length adjustment: 40
Effective length of query: 664
Effective length of database: 733
Effective search space:   486712
Effective search space used:   486712
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory