Align Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6) (characterized)
to candidate RR42_RS01460 RR42_RS01460 glucosamine--fructose-6-phosphate aminotransferase
Query= reanno::ANA3:7025965 (332 letters) >FitnessBrowser__Cup4G11:RR42_RS01460 Length = 612 Score = 127 bits (320), Expect = 6e-34 Identities = 104/311 (33%), Positives = 153/311 (49%), Gaps = 27/311 (8%) Query: 43 VMIVGRGSSDHAGVFAKYLFEIEAGVPTFAAAPSVASVYGKTLKLEGGLVIVISQSGRSP 102 V+I+ G+S ++G AKY E A +PT S Y +T+ LV+VISQSG + Sbjct: 298 VLILACGTSYYSGCTAKYWLESVAKIPTQVEVASEYR-YRETVPNPRALVVVISQSGETA 356 Query: 103 DILAQARMAKNAG-AFCVALVNDETAPIKDIVDVVVPLRAGEEKAVAATKSYLATLSAIL 161 D +A R AK+ G + +A+ N T+ + + RAG E VA+TK++ L+A+ Sbjct: 357 DTMAALRHAKSLGHSHTLAVCNVSTSAMVRETALRFLTRAGTEIGVASTKAFTTQLAALY 416 Query: 162 QLASAWTQ------SESLAAAVNSL---PQALQTAVDAEPQLTPASVENVK--NLVVLGR 210 L A + +E+ AAA+ +L P AL + EPQ+ S + + N + LGR Sbjct: 417 MLTLALAKVRGRLTAEAEAAALTNLRHLPVALHGVLALEPQIISWSEDFARRENALFLGR 476 Query: 211 GLGYAVSKEIALKLKEVCSIHAEAFSSAEFLHGPVTLVEKKLTIVDVCIGDESYASHIEQ 270 GL Y ++ E ALKLKE+ IHAEA+ + E HGP+ LV + + +V V D Sbjct: 477 GLHYPIALEGALKLKEISYIHAEAYPAGELKHGPLALVTEAMPVVTVAPNDALLEKLKSN 536 Query: 271 IENVSQRGADLVHLNQTSTDIHPRVA-PLALLQRFYIDVAAV-------------AIARG 316 I+ V RG L + T IH + L Y D++ + A ARG Sbjct: 537 IQEVRARGGRLYVFADSDTHIHSTEGIQVIRLPEHYGDLSPILHVVPLQLLAYHTACARG 596 Query: 317 IDPDQPAGLKK 327 D D+P L K Sbjct: 597 TDVDKPRNLAK 607 Lambda K H 0.316 0.130 0.357 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 402 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 612 Length adjustment: 33 Effective length of query: 299 Effective length of database: 579 Effective search space: 173121 Effective search space used: 173121 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory