GapMind for catabolism of small carbon sources

 

Aligments for a candidate for actP in Cupriavidus basilensis 4G11

Align Cation/acetate symporter ActP; Acetate permease; Acetate transporter ActP (characterized)
to candidate RR42_RS06400 RR42_RS06400 acetate permease

Query= SwissProt::P32705
         (549 letters)



>lcl|FitnessBrowser__Cup4G11:RR42_RS06400 RR42_RS06400 acetate
           permease
          Length = 546

 Score =  694 bits (1791), Expect = 0.0
 Identities = 358/537 (66%), Positives = 426/537 (79%), Gaps = 2/537 (0%)

Query: 5   LTALAATLPFAANAADAISGAVERQPTNWQAIIMFLIFVVFTLGITYWASKRVRSRSDYY 64
           L A+ A L   A  A A  G+V  Q  N  AI MFL+FV  TL +T WA++   S +D+Y
Sbjct: 6   LCAIGAALLLTALPAFAAPGSVG-QGMNVIAIAMFLMFVAATLVVTRWAARSNHSVADHY 64

Query: 65  TAGGNITGFQNGLAIAGDYMSAASFLGISALVFTSGYDGLIYSLGFLVGWPIILFLIAER 124
            AGG IT  QNG AIAGDYMSAAS LGISALVFTSGYDGLIYS+GFL  WPIILFLIAE 
Sbjct: 65  AAGGKITALQNGWAIAGDYMSAASLLGISALVFTSGYDGLIYSIGFLASWPIILFLIAEP 124

Query: 125 LRNLGRYTFADVASYRLKQGPIRILSACGSLVVVALYLIAQMVGAGKLIELLFGLNYHIA 184
           LRNLGR+T ADV SYRL+Q PIR  SA  S+V+V LYL++QMVGAGKL+ELLFG +Y  A
Sbjct: 125 LRNLGRFTLADVVSYRLRQRPIRAFSASSSIVIVLLYLVSQMVGAGKLVELLFGFSYTAA 184

Query: 185 VVLVGVLMMMYVLFGGMLATTWVQIIKAVLLLFGASFMAFMVMKHVGFSFNNLFSEAMAV 244
           VVLVGVLM++YV FGGMLATTW+QIIKAVLLL GA+FMAFMVM   GFS N LF++A+  
Sbjct: 185 VVLVGVLMVVYVFFGGMLATTWIQIIKAVLLLAGAAFMAFMVMSRFGFSLNALFAQAIEA 244

Query: 245 HPKGVDIMKPGGLVKDPISALSLGLGLMFGTAGLPHILMRFFTVSDAREARKSVFYATGF 304
           H K   IM+PGGLV DP+SA+SLGL L+FGTAGLPHILMRFFTV D + ARKS+ YATG 
Sbjct: 245 HGKHAAIMRPGGLVSDPVSAVSLGLALIFGTAGLPHILMRFFTVGDVKAARKSILYATGI 304

Query: 305 MGYFYILTFIIGFGAIMLVGANPEYKDAAGHLIGGNNMAAVHLANAVGGNLFLGFISAVA 364
           +G  Y L  IIGFG I LV ++P Y   AG +IGG NM AVHLA+AVGGNLFLGFI AVA
Sbjct: 305 VGIGYALIIIIGFGTIALVASDPAYHTPAGAVIGGVNMVAVHLAHAVGGNLFLGFICAVA 364

Query: 365 FATILAVVAGLTLAGASAVSHDLYANVFKKG-ATEREELRVSKITVLILGVIAIILGVLF 423
           F+TILAVVAGLTLAG+SA+SHDLYA V ++G AT++EE+RVS++T L+LGV++I+LG+LF
Sbjct: 365 FSTILAVVAGLTLAGSSAISHDLYAKVLRQGNATDKEEMRVSRMTTLVLGVLSILLGILF 424

Query: 424 ENQNIAFMVGLAFAIAASCNFPIILLSMYWSKLTTRGAMMGGWLGLITAVVLMILGPTIW 483
           E Q IAF+V L F+IAAS NFP++LLS+YW  LTTRGA++GG LGL++AVVL +L PT+W
Sbjct: 425 EKQTIAFIVSLTFSIAASSNFPVLLLSIYWRGLTTRGAVVGGSLGLLSAVVLTVLSPTVW 484

Query: 484 VQILGHEKAIFPYEYPALFSITVAFLGIWFFSATDNSAEGARERELFRAQFIRSQTG 540
           VQ+LGH +AI+PYEYPALFS+ VAF GI+ FS TD SA GARER  F  Q +  + G
Sbjct: 485 VQVLGHARAIYPYEYPALFSMLVAFAGIYVFSVTDRSARGARERGAFNNQLVDCELG 541


Lambda     K      H
   0.329    0.142    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 888
Number of extensions: 42
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 549
Length of database: 546
Length adjustment: 36
Effective length of query: 513
Effective length of database: 510
Effective search space:   261630
Effective search space used:   261630
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory