Align Organic acid uptake porter, DctA of 444 aas and 8 - 10 putative TMSs (characterized)
to candidate RR42_RS19790 RR42_RS19790 C4-dicarboxylate ABC transporter
Query= TCDB::Q848I3 (444 letters) >FitnessBrowser__Cup4G11:RR42_RS19790 Length = 473 Score = 441 bits (1135), Expect = e-128 Identities = 221/404 (54%), Positives = 303/404 (75%), Gaps = 3/404 (0%) Query: 8 YKSLYFQVIVAIAIGILLGHFYPQTGVALKPLGDGFIKLIKMVIAPIIFCTVVSGIAGMQ 67 ++SL+ QV+VA+ +G LG +P+ LKPLGD FIKLIKM+I PI+FC VV+GI G Sbjct: 25 FRSLFGQVLVALVLGTALGLLFPEFAAKLKPLGDAFIKLIKMLIGPIVFCVVVAGICGAG 84 Query: 68 NMKSVGKTGGYALLYFEIVSTIALLIGLVVVNVVQPGNGMHIDVSTLDASKVAAYVTAG- 126 +K VG+ G A+LYFE+V+TIAL +G+ + + PG GM+++ ++LDAS ++AYV Sbjct: 85 ELKKVGRVGIKAVLYFEVVTTIALALGIALAYIFHPGTGMNVNPASLDASAMSAYVDTAQ 144 Query: 127 --KDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGAYGKPVLDFIDRFA 184 K +V F+L +IP+T++GAFA+GD+LQVL+ S++FG AL +G G+P++ ID F+ Sbjct: 145 KVKSAGMVDFLLKLIPSTVMGAFASGDVLQVLLVSILFGCALSLVGERGQPLVTIIDTFS 204 Query: 185 HVMFNIINMIMKLAPIGALGAMAFTIGAYGVGSLVQLGQLMICFYITCVLFVLVVLGAIC 244 H +F ++ I+KLAP+G LGA+AFT+G YG+GSL QLG L++ FY LFV+VVLG + Sbjct: 205 HTLFKMMGFIIKLAPLGVLGAVAFTVGKYGIGSLKQLGYLVLVFYGAVALFVMVVLGTVM 264 Query: 245 RAHGFSVLKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSFNL 304 R GFSV KLIRY+R ELL+VLGT+SS+S LP+++ K+E LG KKSVVGLVIPTGYSFNL Sbjct: 265 RLCGFSVFKLIRYLRAELLVVLGTASSDSVLPQVMKKLEFLGIKKSVVGLVIPTGYSFNL 324 Query: 305 DGTSIYLTMAAVFIAQATDTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSAVG 364 D SIYLT+AAVFIAQAT+T + + + +L V L++SKGA G+ GS ++LAATLSA Sbjct: 325 DAFSIYLTLAAVFIAQATNTPLALGDLLGILAVALVTSKGAHGIPGSAIVILAATLSAHP 384 Query: 365 HLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVKELD 408 +P GL L+L +D F+ ARA+ NL+GN VATVVVA W K++D Sbjct: 385 AIPAIGLVLVLSVDWFIGIARAVGNLIGNCVATVVVAAWEKDID 428 Lambda K H 0.326 0.142 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 634 Number of extensions: 32 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 473 Length adjustment: 33 Effective length of query: 411 Effective length of database: 440 Effective search space: 180840 Effective search space used: 180840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory