Align Glyceraldehyde dehydrogenase medium chain; Glyceraldehyde dehydrogenase subunit B; Glyceraldehyde dehydrogenase subunit beta; EC 1.2.99.8 (characterized)
to candidate RR42_RS26500 RR42_RS26500 carbon monoxide dehydrogenase
Query= SwissProt::Q4J6M6 (281 letters) >FitnessBrowser__Cup4G11:RR42_RS26500 Length = 275 Score = 115 bits (288), Expect = 1e-30 Identities = 72/194 (37%), Positives = 107/194 (55%), Gaps = 2/194 (1%) Query: 6 FSYVRAESLQEALKFL-EGNDNTRPLAGGQSLIPMLKLRVLSPDYILDINRLNELNYVKT 64 F+Y A +L L + DN + + GGQS+ PML LR+ PD I D+++L EL V Sbjct: 6 FTYHAAPTLAATCAELADRTDNAKVMGGGQSMGPMLNLRLTRPDAIYDLSKLAELRTVTL 65 Query: 65 SLNGVSIGALTRYHDILSNDIVKSKVPLMHHATRTIGDMQVRNMGTIGGAISNADPASDM 124 + V IGA + I + + ++ I +RN GTIGG++++ADPA+D Sbjct: 66 LQDRVRIGAAVTHAQIEDGEFPALRGGMLQSVASGIAYRAIRNRGTIGGSLAHADPAADW 125 Query: 125 PVVLTALNATIILSSASGSRSVKALDFFKGPFTTDTNKGELVTQIEVPVL-DGYKTVYKK 183 VVLTA+ A I L+S +G+R V F G +TT +GEL+ + VP D + Y K Sbjct: 126 VVVLTAVGAQIELASKAGTRIVPMTAFMLGAYTTALTEGELICAVHVPSQPDTARWGYHK 185 Query: 184 VVRRAGDYALASVA 197 + R+ G++A AS A Sbjct: 186 LCRKTGEFAEASCA 199 Lambda K H 0.316 0.134 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 275 Length adjustment: 25 Effective length of query: 256 Effective length of database: 250 Effective search space: 64000 Effective search space used: 64000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory