Align Inner-membrane translocator (characterized, see rationale)
to candidate RR42_RS32895 RR42_RS32895 ABC transporter permease
Query= uniprot:A0KWY6 (405 letters) >FitnessBrowser__Cup4G11:RR42_RS32895 Length = 318 Score = 151 bits (381), Expect = 3e-41 Identities = 91/274 (33%), Positives = 149/274 (54%), Gaps = 2/274 (0%) Query: 96 SLIDILNRSAPVALLSIGMSLVIATGGIDLSVGAVMAIAGAVCANLLLVPDISLVTVIAA 155 +L++I +S + L+++ M+L+I T G+DLS+GAV+ + G V A +++V SL + A Sbjct: 44 NLLNIGAQSTILLLIALPMTLIIMTEGLDLSMGAVLTLCGVVLA-MVMVATESLPLALGA 102 Query: 156 GLIVGLLAGCINGGLVSFLGIQPIVATLLLMVAGRGVAQLINQGQIITFQHPGFAAIGVG 215 L+ GL G +NG LVS+L I P VATL + +G+A + GQ +T I G Sbjct: 103 ALLTGLAFGLLNGALVSWLEIPPFVATLGTLGVAQGLALVATDGQSVTGIGEAIPLIYAG 162 Query: 216 QFLGLPMPVWIVIGMLTFSQLLLRKTALGLFIEAVGCNAKASRYLGINDKSIKLFAYGIA 275 Q LG+P+P+WI LL T G ++ A+G N +A ++ G+ + Y + Sbjct: 163 QLLGVPLPIWIAAVFYGLFHWLLYHTRFGAYVFALGGNREALKFSGVRINVYLIAVYALG 222 Query: 276 GLCAALAGMISTADIQGSDANNAGLWLELDAVLAVVIGGAALTGGRFSLILSVVGALIIQ 335 GL A +A ++ TA + A + LE DA+ AV +GG G L +V+G L + Sbjct: 223 GLMAGVAALLLTARMNAGHP-TAAIGLEFDAIAAVAVGGTTFDRGNGWLPGTVLGVLAVG 281 Query: 336 TLATTIIVSGLPAKFNLLIKAIVILTVLLLQSAK 369 L + + G+P+ + +++L VLL++S K Sbjct: 282 VLRNGLNLVGVPSSVQVAAIGLLVLVVLLIESFK 315 Lambda K H 0.323 0.136 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 318 Length adjustment: 29 Effective length of query: 376 Effective length of database: 289 Effective search space: 108664 Effective search space used: 108664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory