Align glyoxylate reductase (EC 1.1.1.26); 4-hydroxybutyrate dehydrogenase (EC 1.1.1.61); glyoxylate reductase (NADP+) (EC 1.1.1.79) (characterized)
to candidate RR42_RS19860 RR42_RS19860 tartronate semialdehyde reductase
Query= BRENDA::Q9LSV0 (289 letters) >FitnessBrowser__Cup4G11:RR42_RS19860 Length = 308 Score = 130 bits (328), Expect = 3e-35 Identities = 89/290 (30%), Positives = 141/290 (48%), Gaps = 8/290 (2%) Query: 3 VGFLGLGIMGKAMSMNLLKNGFKVTVWNRTLSKCDELVEHGASVCESPAEVIKKCKYTIA 62 VGF+GLGIMG M+ +L G + V + + LV+ G +VC S EV K+ + Sbjct: 7 VGFIGLGIMGAPMAGHLRAAGHTLFVHDVNPAP-QALVDAGVTVCTSAEEVAKRADIIVI 65 Query: 63 MLSDPCAALSVVFDKGGVL-------EQICEGKGYIDMSTVDAETSLKINEAITGKGGRF 115 M+ D +V+F + GV +Q GK +DMS++ + + G + Sbjct: 66 MVPDTPHVEAVLFAEKGVAAALKGAGKQAAHGKIVVDMSSISPIATKDFAARVNKLGAAY 125 Query: 116 VEGPVSGSKKPAEDGQLIILAAGDKALFEESIPAFDVLGKRSFYLGQVGNGAKMKLIVNM 175 ++ PVSG + A+ L I+ G + F+E P FD+LGK +G G+G K+ + Sbjct: 126 LDAPVSGGEVGAKAASLTIMVGGPQESFDEVKPLFDLLGKNVTLVGGNGDGQTTKVANQI 185 Query: 176 IMGSMMNAFSEGLVLADKSGLSSDTLLDILDLGAMTNPMFKGKGPSMNKSSYPPAFPLKH 235 I+ + A SE L+ A K+G + L G + + + G M K ++ P F ++ Sbjct: 186 IVALNIQAVSEALLFASKAGADPARVRQALMGGFAASRILEVHGERMVKRTFDPGFRIEL 245 Query: 236 QQKDMRLALALGDENAVSMPVAAAANEAFKKARSLGLGDLDFSAVIEAVK 285 QKD+ LAL V++P A A E F + GLG D SA+ A++ Sbjct: 246 HQKDLNLALQGAKALGVALPNTATAQELFNTCAANGLGKQDHSALCRAIE 295 Lambda K H 0.317 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 308 Length adjustment: 27 Effective length of query: 262 Effective length of database: 281 Effective search space: 73622 Effective search space used: 73622 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory