Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate RR42_RS18590 RR42_RS18590 hypothetical protein
Query= uniprot:D4GP39 (383 letters) >FitnessBrowser__Cup4G11:RR42_RS18590 Length = 359 Score = 300 bits (768), Expect = 4e-86 Identities = 170/355 (47%), Positives = 226/355 (63%), Gaps = 16/355 (4%) Query: 19 GDIVAVEEISLDIDDGEFLVLVGPSGCGKSTTLRMMAGLETVTEGELRLEDRVLNGVSAQ 78 G + + +DI DG+F VLVGPSGCGKST LRM+AGLE +T GE+ + +RV+N + + Sbjct: 14 GSTQVIRGVDIDIADGQFTVLVGPSGCGKSTLLRMIAGLEEITTGEIAIGNRVVNRLPPK 73 Query: 79 DRDIAMVFQSYALYPHKSVRGNMSFGLEESTGLPDDEIRQRVEETTDMLGISDLLDRKPG 138 +RDIAMVFQ+YALYPH +V NM+F L+ + G +EI+++V + + +LG+ LL+R P Sbjct: 74 ERDIAMVFQNYALYPHMTVYDNMAFSLKLAKG-DKEEIKRKVAKASAILGLDSLLERYPR 132 Query: 139 QLSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQRLQGELGVTTVYVTH 198 QLSGGQ+QRVA+GRAIVRDP+VFL DEPLSNLDAKLR +MR E++ L L T+VYVTH Sbjct: 133 QLSGGQRQRVAMGRAIVRDPQVFLFDEPLSNLDAKLRVQMRAEIKELHQRLRTTSVYVTH 192 Query: 199 DQTEAMTMGDRVAVLDDGELQQVGTPLDCYHRPNNLFVAGFIGEPSMNLFDGSL---SGD 255 DQ EAMTM D++ V+ DG ++Q G PL Y P+NLFVAGFIG P+MN G L GD Sbjct: 193 DQIEAMTMADQIVVMRDGRVEQRGKPLALYDHPDNLFVAGFIGSPAMNFVPGVLRRSGGD 252 Query: 256 TF--RGDGFDYPLSGATRDQLGGASG--LTLGIRPEDVTVGERRSGQRTFDAEVVVVEPQ 311 DG P + A D G G + G+RPE +T+G G +T V VVEP Sbjct: 253 AAVEFPDGTRLP-APARFDATAGTDGQRVIYGVRPEHLTLGMPGQGLQT---RVSVVEPT 308 Query: 312 GNENAVHLRFVDGDEGTQFTATTTGQSRVEAGDRTTVSFPEDAIHLFDGETGDAL 366 G ++ RF + +F + + AGD + HLFD ++G L Sbjct: 309 GANTEIYSRFCE----AEFISIFRERHDFAAGDILNLVPDHQHTHLFDADSGQTL 359 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 448 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 359 Length adjustment: 30 Effective length of query: 353 Effective length of database: 329 Effective search space: 116137 Effective search space used: 116137 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory