Align Arginine decarboxylase proenzyme; ADC; ArgDC; EC 4.1.1.19; Pyruvoyl-dependent arginine decarboxylase (uncharacterized)
to candidate RR42_RS19905 RR42_RS19905 S-adenosylmethionine decarboxylase
Query= curated2:A2BM05 (142 letters) >FitnessBrowser__Cup4G11:RR42_RS19905 Length = 125 Score = 75.1 bits (183), Expect = 3e-19 Identities = 44/117 (37%), Positives = 65/117 (55%), Gaps = 2/117 (1%) Query: 19 IVGKHVYGNLYGVDEEKLWDEELLKDIVVEAARVANMNLVDIKTWKFTGFHGGVSVIALV 78 ++G H+ +L GV + L D L++ ++ AA+ A +VD + F G GV+ + L+ Sbjct: 11 VLGHHLLADLQGVASDLLADAALVERVLYRAAQAAGATVVDARFRHF-GPGLGVTGVLLL 69 Query: 79 LESHISIHTWPDYGYATVDVYTCGANSDPWKAFNYIVLKLKPRYYIVHYADRSSIPG 135 ESHISIHTWP+YG+A VDV+ CGA + P A + PR + R PG Sbjct: 70 KESHISIHTWPEYGFAAVDVFMCGA-ARPELAVEVMRAAFVPRTLTLRDQARGPAPG 125 Lambda K H 0.318 0.137 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 40 Number of extensions: 2 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 142 Length of database: 125 Length adjustment: 15 Effective length of query: 127 Effective length of database: 110 Effective search space: 13970 Effective search space used: 13970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 42 (20.8 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory