Align Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter periplasmic binding protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate RR42_RS04395 RR42_RS04395 cysteine ABC transporter substrate-binding protein
Query= TCDB::Q9HU31 (250 letters) >FitnessBrowser__Cup4G11:RR42_RS04395 Length = 265 Score = 114 bits (285), Expect = 2e-30 Identities = 80/241 (33%), Positives = 129/241 (53%), Gaps = 12/241 (4%) Query: 11 AAATLAFALDA-SAADKLRIGTEGAYPPFNGIDASGQAVGFDLDIGKALCAKMKTECEVV 69 AAA A LD A L+IG EG YPPFN ++ Q GFD+D+ K + AK+ + E V Sbjct: 22 AAAQAADLLDTVKQAGVLKIGLEGTYPPFNYRGSNNQLEGFDVDVAKGVAAKLGVKPEFV 81 Query: 70 TSDWDGIIPALNAKKFDFIVASMSITDERKQAVDFTDPYYTNKLQFVAPK--SVDFKTDK 127 T++W GII L A KFD IV +++T +RKQ +DF+ PY + Q + K + FK+ + Sbjct: 82 TTEWSGIIAGLQAGKFDVIVNQVAVTPQRKQVLDFSTPYVYSAAQLIQRKDDNRQFKSLE 141 Query: 128 DSLKGKVIGAQRATIAGTWLEDNMADVVTIKLYDTQENAYLDLSSGRLDGVLADKFVQYD 187 D LKGK +G + L ++A + +K Y DL++ R+D L D+ + Sbjct: 142 D-LKGKKLGVSLGSNYNE-LAKSVAG-IDVKTYPGAPEYLRDLAAQRVDAALNDRLMIGY 198 Query: 188 WLKSDAGKEFEFKGEPVFD--NDKIGIAVRKGDP-LREKLNAALKEIVADGTYKKINDKY 244 +K+ + + + N ++ I RK +P + ++ AL E+ DG+ K++ ++ Sbjct: 199 LIKT---SNLPLRPGAIVEGGNSEVAIPFRKDNPKFAQAIDRALDEMRKDGSLGKLSARW 255 Query: 245 F 245 F Sbjct: 256 F 256 Lambda K H 0.317 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 265 Length adjustment: 24 Effective length of query: 226 Effective length of database: 241 Effective search space: 54466 Effective search space used: 54466 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory