Align lysine/arginine/ornithine ABC transporter, periplasmic lysine/arginine/ornithine-binding protein ArgT (characterized)
to candidate RR42_RS29645 RR42_RS29645 ABC transporter substrate-binding protein
Query= CharProtDB::CH_003045 (260 letters) >FitnessBrowser__Cup4G11:RR42_RS29645 Length = 199 Score = 210 bits (535), Expect = 2e-59 Identities = 105/189 (55%), Positives = 134/189 (70%), Gaps = 1/189 (0%) Query: 72 SDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQPTLESL 131 + FD +IP+L+A+K DAI SS+S ++R + I F+ KLYA L+ KGSP+ T ESL Sbjct: 10 NSFDGMIPALQARKFDAINSSMSKNEQRLKVIDFTSKLYAPIEALVVKKGSPLVATAESL 69 Query: 132 KGKHVGVLQGSTQEAYANDNWRTKGVDVVAYANQDLIYSDLTAGRLDAALQDEVAASEGF 191 KGK VGVLQGSTQE YA W GVD+V Y QDLI+ DL AGR+DAA+ A GF Sbjct: 70 KGKRVGVLQGSTQETYARKYWGGNGVDIVPYQTQDLIWPDLIAGRIDAAMAFAPQADAGF 129 Query: 192 LKQPAGKEYAFA-GPSVKDKKYFGDGTGVGLRKDDTELKAAFDKALTELRQDGTYDKMAK 250 LK P GK++ FA GP++KD FG G +G+RKDDT L+ A + A+ LR+DGTYDK+AK Sbjct: 130 LKTPPGKDFVFAQGPAIKDDSIFGPGVSIGVRKDDTALRDAINGAIDSLRKDGTYDKIAK 189 Query: 251 KYFDFNVYG 259 KYF+FN+YG Sbjct: 190 KYFNFNIYG 198 Lambda K H 0.315 0.132 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 199 Length adjustment: 22 Effective length of query: 238 Effective length of database: 177 Effective search space: 42126 Effective search space used: 42126 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory