Align arginine-pyruvate transaminase (EC 2.6.1.84) (characterized)
to candidate RR42_RS35305 RR42_RS35305 aspartate aminotransferase
Query= BRENDA::Q9HUI9 (393 letters) >FitnessBrowser__Cup4G11:RR42_RS35305 Length = 401 Score = 214 bits (545), Expect = 3e-60 Identities = 128/373 (34%), Positives = 196/373 (52%), Gaps = 15/373 (4%) Query: 31 GEEILLLSVGDPDFDTPAPIVQAAIDSLLAGNTHYADVRGKRALRQRIAERHRRRSGQAV 90 G +++ L+ G+PDF+TPA I +AA ++ AG T Y DV G LR A++ +R +G Sbjct: 30 GRDVIGLTAGEPDFETPAHIREAAWRAMQAGKTRYTDVGGTAELRHAAAQKFKRENGLDY 89 Query: 91 DAEQVVVLAGAQCALYAVVQCLLNPGDEVIVAEPMYVTYEAVFGACGARVVPVPVRSENG 150 A +++V GA+ ++ + C + GDEVIV P +V+Y + G V V ++ENG Sbjct: 90 AASEIIVSTGAKQVIFNALMCTVQQGDEVIVPAPYWVSYPDITLFAGGVPVFVACQAENG 149 Query: 151 FRVQAEEVAALITPRTRAMALNSPHNPSGASLPRATWEALAELCMAH-DLWMISDEVYSE 209 F++ EE+ I+ RTR + LNSP+NPSGA+ R A+AE+ H +W+++D++Y Sbjct: 150 FKLTPEELERAISARTRWLILNSPNNPSGAAYTRTELVAIAEVLERHPHVWVMTDDIYEH 209 Query: 210 LLFDGEH--VSPASLPGMADRTATLNSLSKSHAMTGWRVGWVVGPAALCAHLENLALCML 267 L +DG + P + RT T+N +SK++AMTGWR+G+ PA L + L Sbjct: 210 LTYDGAAFVTLAQAAPSLKARTLTINGVSKAYAMTGWRIGYAGAPAPLIKAMVKLQSQST 269 Query: 268 YGSPEFIQDAACTALEAPLPELEAMREAYRRRRDLVIECLADSPGLRPLRPDGGMFVMVD 327 G+ Q AA AL+ P + A + ++ RRD V+ L G+ P G +V Sbjct: 270 SGANAVAQAAAIAALDGPQDFIAANKAVFQARRDRVVAALGQVDGIHCQAPAGAFYVFAS 329 Query: 328 IR-------PTG---LSAQAFADRLLDRHGVSVLAGEAFGPSAAGHIRLGLVLGAEPLRE 377 P G S+ + + +LD ++VL G A+G H RL L E Sbjct: 330 CEALIGARTPHGSVIRSSDDWVNWVLDSQDLAVLQGSAYGVDT--HFRLSFAASMAQLDE 387 Query: 378 ACRRIALCAAELL 390 CRRI AA L+ Sbjct: 388 GCRRIEAAAAALI 400 Lambda K H 0.322 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 430 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 401 Length adjustment: 31 Effective length of query: 362 Effective length of database: 370 Effective search space: 133940 Effective search space used: 133940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory