Align 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized)
to candidate RR42_RS25010 RR42_RS25010 betaine-aldehyde dehydrogenase
Query= metacyc::MONOMER-11560 (497 letters) >FitnessBrowser__Cup4G11:RR42_RS25010 Length = 485 Score = 413 bits (1061), Expect = e-120 Identities = 216/477 (45%), Positives = 299/477 (62%), Gaps = 5/477 (1%) Query: 21 RAFINGEYTDAVSGETFECLSPVDGRFLAKVASCDLADANRAVENARATFNSGVWSQLAP 80 R I G + +A SG+TFE ++P L VA + AD + AV AR F++ W ++P Sbjct: 14 RLLIGGRWVEAASGKTFEVINPSTEELLCHVAEANSADIDAAVAAARHAFDNSSWVGMSP 73 Query: 81 AKRKAKLIRFADLLRKNVEELALLETLDMGKPIGDSSSIDIPGAAQAIHWTAEAIDKVYD 140 R L+R AD + ++ +ELA +ETLD G P+ S+++ AA + K+ Sbjct: 74 HARTRALLRIADQIDRHADELAAIETLDNGMPLWFSTAVATT-AADIFRYYGGWCTKILG 132 Query: 141 EVAPTPHDQLGLVTREPVGVVGAIVPWNFPLLMACWKLGPALATGNSVVLKPSEKSPLTA 200 P+ REP+GV G I+PWN P+LMA KL AL GN+++LKP+E + LT+ Sbjct: 133 STIPSDASGFVYTLREPLGVCGQIIPWNVPILMASIKLANALCCGNTLILKPAELACLTS 192 Query: 201 IRIAQLAIEAGIPAGVLNVLPGYGHTVGKALALHMDVDTLVFTGSTKIAKQLMVYAGESN 260 +R+A+L E +P GV+N+LPG+G T G ALALH DVD + FTGST I KQ+ V A SN Sbjct: 193 LRLAELIQETDLPPGVINMLPGFGATAGAALALHPDVDKIAFTGSTAIGKQI-VQASTSN 251 Query: 261 MKRIWLEAGGKSPNIVFADAPDLQAAAEAAASAIAFNQGEVCTAGSRLLVERSIKDKFLP 320 +K++ LE GGKSPN++FADA DL A +AA N G+VC+AG+RL V S+ D+ Sbjct: 252 LKKVTLELGGKSPNVIFADA-DLDKAVQAAVKTFCGNSGQVCSAGTRLFVHESVHDEVSE 310 Query: 321 MVVEALKGWKPGNPLDPQTTVGALVDTQQMNTVLSYIEAGHKDGAKLLAGGKRTLEETGG 380 V + G+PL P T +G L+ +Q + VLSYIEAG GA L GG + G Sbjct: 311 RVTRLAATYTVGDPLAPDTKLGPLISAKQRDRVLSYIEAGQAGGASLQLGGSQWSGR--G 368 Query: 381 TYVEPTIFDGVTNAMRIAQEEIFGPVLSVIAFDTAEEAVAIANDTPYGLAAGIWTSDISK 440 +V P +FDGVTN MRIAQEEIFGPVLS+I F ++AV NDT YGL+A +WT D+++ Sbjct: 369 YFVAPAVFDGVTNGMRIAQEEIFGPVLSIIPFRDEDDAVFKGNDTTYGLSAAVWTRDVAR 428 Query: 441 AHKTARAVRAGSVWVNQYDGGDMTAPFGGFKQSGNGRDKSLHALEKYTELKATWIKL 497 AHK ARA++AG VW+N Y D PFGG+KQSG GR+ +++ YT++KA +++ Sbjct: 429 AHKVARALKAGRVWINTYGEADPAMPFGGYKQSGWGREFGQESIDAYTQVKAVMLRM 485 Lambda K H 0.316 0.132 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 662 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 485 Length adjustment: 34 Effective length of query: 463 Effective length of database: 451 Effective search space: 208813 Effective search space used: 208813 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory