Align gamma-glutamylputrescine oxidase (EC 1.4.3.-) (characterized)
to candidate RR42_RS07820 RR42_RS07820 hypothetical protein
Query= reanno::pseudo5_N2C3_1:AO356_21495 (427 letters) >FitnessBrowser__Cup4G11:RR42_RS07820 Length = 431 Score = 184 bits (468), Expect = 3e-51 Identities = 134/430 (31%), Positives = 208/430 (48%), Gaps = 24/430 (5%) Query: 9 SYYAASANPVPPRPALQDDVETDVCVIGAGYTGLSSALFLLENGFKVTVLEAAKVGFGAS 68 S +AA+A P A++ ++ DV ++G G+TGLS+AL L + G + EA ++G AS Sbjct: 11 SLWAATALPRTASEAVRGPLQVDVAIVGGGFTGLSAALHLAQAGVHTALFEAFEIGHRAS 70 Query: 69 GRNGGQIVNSYSRDIDVIERSVGPQQAQLLGNMAFEGGRIIRERVAKYQIQCD-LKDGGV 127 GRNGGQ+V + + G A+ + +A+ + V +YQI+C ++G + Sbjct: 71 GRNGGQVVPGVKPPPSALTKRFGDDTARRMMRLAYGSADELFALVERYQIRCQPTRNGWL 130 Query: 128 FAALTAKQMGHLESQK-RLWERFGHTQLELLDQRRIREVVACEEYVGGMLDMSGGHIHPL 186 A + G+L + + + G+T LD+ +R + + G+L+ S G + PL Sbjct: 131 QGAYSQASSGYLRQRSHEINGQGGNT--TYLDRDEMRAATGSDYWPSGLLEKSAGAVQPL 188 Query: 187 NLALGEAAAVESLGGVIYEQSPAVRIERGASPVVHTPQG-KVRAKFIIVAGNAYLGNLVP 245 A G A AV LGG ++E SP I A G V+A+ +I+A +AY LVP Sbjct: 189 AYARGLARAVTDLGGTLHEYSPVQSISTSAGRFKLQVNGHAVQARKVILATDAYTDRLVP 248 Query: 246 ELAAKSMPCGTQVIATEPLGDELAHSLLPQDYCVEDCNYLLDYYRLTGDKRLIFGGGVVY 305 E+A + + IAT+PL EL LLP + + + Y RL + R + GG Sbjct: 249 EVAQSYVNVSSAQIATDPLPPELQQRLLPLRAGISETRKITYYCRLDPEGRFVIGG---- 304 Query: 306 GARDPANIEAIIRPKMLKA----FPQLKDVKIDYAWTGNFLLTLSRLPQVGRLGDNIYYS 361 RD N++ R ++ A FP+L DV + W +T+ LP + L D ++ + Sbjct: 305 RGRDSDNLDPATREQLRLAACQRFPELNDVVFTHGWACRVGMTIDDLPHLHELADGLWAA 364 Query: 362 QGCSGHGVTYTHLAGKVLAEALRGQ-AERFD----AFADLPHYPFPGGQLLRTPFAAMGA 416 G G GV + G+VL EA+RG A D LP YP +R A Sbjct: 365 YGYCGRGVAMGTVLGRVLGEAVRGMPAAALDYPVTPVKRLPLYP------VRQVSAMAAL 418 Query: 417 WYYGLRDKLG 426 +Y LRD +G Sbjct: 419 QWYRLRDAMG 428 Lambda K H 0.320 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 512 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 431 Length adjustment: 32 Effective length of query: 395 Effective length of database: 399 Effective search space: 157605 Effective search space used: 157605 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory