Align agmatinase (EC 3.5.3.11) (characterized)
to candidate RR42_RS02455 RR42_RS02455 agmatinase
Query= BRENDA::W5PHZ9 (361 letters) >FitnessBrowser__Cup4G11:RR42_RS02455 Length = 328 Score = 391 bits (1005), Expect = e-113 Identities = 191/307 (62%), Positives = 229/307 (74%) Query: 52 QPPSSEFVARSVGICSMMRLPMQATPEGLDAALVGVPLDIGTSNRPGARFGPRRIREESV 111 QP S + R GI +MMRLP A+ GLDA VGVP D+GTSNR GAR GPR+IR ESV Sbjct: 17 QPMSGNAMPRFGGIATMMRLPAAASTAGLDACFVGVPFDLGTSNRNGARLGPRQIRAESV 76 Query: 112 MLRTANPSTGAVPFQFLKVADLGDVNVNLYNLQDSCRLIRADYQKIVAAGCVPLTLGGDH 171 +LR N +T A PF L+VAD+GDV N YNL D+ I A Y+ I+A GC P+ LGGDH Sbjct: 77 LLRPYNMATRAAPFDSLRVADIGDVATNPYNLHDAIARIEAAYRDIIATGCRPIGLGGDH 136 Query: 172 TITYPILQAIAEKHGPVGLVHVDAHMDTADKALGEKLYHGTPFRRCVDEGLLDCKRVVQI 231 T+T PIL+A+ +HG +GL+HVDAH D D GEK+ HGTPFRR V+EGLLDC RVVQI Sbjct: 137 TVTLPILRAMHARHGRLGLIHVDAHADVNDTMFGEKIAHGTPFRRAVEEGLLDCGRVVQI 196 Query: 232 GIRGSSTTLDTYRYSRSQGFRVVLAEDCWLKSLVPLMGEVRQQMGGRPIYISFDIDGLDP 291 G+RG+ + + + R QGFRV+ AE CW +SL PLM E+ ++ G P+YISFDIDG+DP Sbjct: 197 GLRGTGYAAEDFDWCRQQGFRVITAEACWYRSLAPLMEEIGMRLQGGPVYISFDIDGIDP 256 Query: 292 AYAPGTGTPEIAGLTPSQALEIIRGCQGLNVVGCDLVEVSPPYDPSGNTALVAANLLFEM 351 AYAPGTGTPEI GLT QALEIIRG +GL++VG DLVEVSPPYDP G TAL+ ANL FE+ Sbjct: 257 AYAPGTGTPEIGGLTVPQALEIIRGARGLDIVGADLVEVSPPYDPFGTTALLGANLAFEL 316 Query: 352 LCVLPKV 358 LCVLP V Sbjct: 317 LCVLPGV 323 Lambda K H 0.321 0.139 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 449 Number of extensions: 18 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 328 Length adjustment: 29 Effective length of query: 332 Effective length of database: 299 Effective search space: 99268 Effective search space used: 99268 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate RR42_RS02455 RR42_RS02455 (agmatinase)
to HMM TIGR01230 (speB: agmatinase (EC 3.5.3.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01230.hmm # target sequence database: /tmp/gapView.9897.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01230 [M=275] Accession: TIGR01230 Description: agmatinase: agmatinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-63 201.0 0.0 1.9e-63 200.7 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS02455 RR42_RS02455 agmatinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS02455 RR42_RS02455 agmatinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 200.7 0.0 1.9e-63 1.9e-63 10 274 .. 42 318 .. 33 319 .. 0.91 Alignments for each domain: == domain 1 score: 200.7 bits; conditional E-value: 1.9e-63 TIGR01230 10 yeeAevvivgiPydattsyrpGsrhgpeaireastnLeayseeld.rdlallkvvDagdlplaaGdare 77 ++ ++ vg+P+d ts r+G+r gp +ir s+ L y+ ++ l+v+D gd+ + + ++ lcl|FitnessBrowser__Cup4G11:RR42_RS02455 42 TAGLDACFVGVPFDLGTSNRNGARLGPRQIRAESVLLRPYNMATRaAPFDSLRVADIGDVATNPYNLHD 110 455688899*******************************98877588**************99999** PP TIGR01230 78 mvekieevveelleegkfvvaiGGeHsitlpvirAvkkkfeklavvqfDAHtDlrdefegeklshacvm 146 + +ie+ +++++ g +++++GG+H++tlp++rA++ +++ l ++++DAH+D+ d gek+ h ++ lcl|FitnessBrowser__Cup4G11:RR42_RS02455 111 AIARIEAAYRDIIATGCRPIGLGGDHTVTLPILRAMHARHGRLGLIHVDAHADVNDTMFGEKIAHGTPF 179 ********************************************************************* PP TIGR01230 147 rrvlelg....lnvlqigiRsg..ikeeadlarennikvl.....k.reledeiaevlakvldkpvyvt 203 rr++e g +v+qig+R e++d+ r+++ +v+ + r+l+ ++e +++ + pvy++ lcl|FitnessBrowser__Cup4G11:RR42_RS02455 180 RRAVEEGlldcGRVVQIGLRGTgyAAEDFDWCRQQGFRVItaeacWyRSLAPLMEEIGMRLQGGPVYIS 248 *****99766669*******753378**********9997222223345555588888899999***** PP TIGR01230 204 iDiDvlDPafaPGvgtpepgGltskellklfvlaekekkvvGlDvvEvaPvydssevtaltaaklalel 272 +DiD++DPa+aPG+gtpe+gGlt ++l+ ++ +vG+D+vEv+P yd tal+ a+la el lcl|FitnessBrowser__Cup4G11:RR42_RS02455 249 FDIDGIDPAYAPGTGTPEIGGLTVPQALE-IIRGARGLDIVGADLVEVSPPYDPFGTTALLGANLAFEL 316 *****************************.8899999*******************************9 PP TIGR01230 273 ll 274 l lcl|FitnessBrowser__Cup4G11:RR42_RS02455 317 LC 318 96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (275 nodes) Target sequences: 1 (328 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.09 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory