Align glutamate-aspartate periplasmic-binding protein (characterized)
to candidate RR42_RS04390 RR42_RS04390 ABC transporter
Query= CharProtDB::CH_002441 (302 letters) >FitnessBrowser__Cup4G11:RR42_RS04390 Length = 306 Score = 331 bits (849), Expect = 1e-95 Identities = 168/292 (57%), Positives = 214/292 (73%), Gaps = 2/292 (0%) Query: 10 ILALALSAGLAQADDAAPAA-GSTLDKIAKNGVIVVGHRESSVPFSYYDNQQKVVGYSQD 68 +LA+A+ AG A A A AA G TL KI + GVI +G+RESS+PFSY N + V+GYS + Sbjct: 14 LLAVAMLAGTAGAVSNAHAADGDTLRKIKETGVISLGYRESSIPFSY-TNGRDVMGYSHE 72 Query: 69 YSNAIVEAVKKKLNKPDLQVKLIPITSQNRIPLLQNGTFDFECGSTTNNVERQKQAAFSD 128 IV+ VK +L P L +KL+PITSQNRI L+QNGT D ECG+TTNN+ERQKQ AFS+ Sbjct: 73 ILLQIVDKVKAQLQNPKLDIKLVPITSQNRISLMQNGTIDIECGTTTNNLERQKQVAFSN 132 Query: 129 TIFVVGTRLLTKKGGDIKDFANLKDKAVVVTSGTTSEVLLNKLNEEQKMNMRIISAKDHG 188 ++FV G R+LT+K +KDF +LKD+ VV T+GTT E LL K+N E+ MNM +ISAKDHG Sbjct: 133 SLFVYGLRMLTRKDSGVKDFPDLKDRNVVTTAGTTDERLLVKMNGEKTMNMNLISAKDHG 192 Query: 189 DSFRTLESGRAVAFMMDDALLAGERAKAKKPDNWEIVGKPQSQEAYGCMLRKDDPQFKKL 248 SF LE+GRAVAF+MD+ LL GE KAK ++W +VG P E Y CM RKDDP FK L Sbjct: 193 QSFLILETGRAVAFVMDEPLLYGELTKAKSANDWTVVGTPLQTENYACMFRKDDPSFKAL 252 Query: 249 MDDTIAQVQTSGEAEKWFDKWFKNPIPPKNLNMNFELSDEMKALFKEPNDKA 300 D IA + TSG AE+ + KWF++PIPP+N+N+N+ LS +MK L+ PNDKA Sbjct: 253 ADGVIADLMTSGRAEQLYKKWFQSPIPPRNINLNYPLSADMKDLYAHPNDKA 304 Lambda K H 0.314 0.130 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 306 Length adjustment: 27 Effective length of query: 275 Effective length of database: 279 Effective search space: 76725 Effective search space used: 76725 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory