Align beta-aspartyl-peptidase (EC 3.4.19.5); asparaginase (EC 3.5.1.1) (characterized)
to candidate RR42_RS12000 RR42_RS12000 isoaspartyl peptidase
Query= BRENDA::P37595 (321 letters) >FitnessBrowser__Cup4G11:RR42_RS12000 Length = 317 Score = 363 bits (932), Expect = e-105 Identities = 195/317 (61%), Positives = 231/317 (72%), Gaps = 7/317 (2%) Query: 1 MGKAVIAIHGGAGAISRAQMSLQQELRYIEALSAIVETGQKMLEAGESALDVVTEAVRLL 60 M VIAIHGGAG I+RA MS ++ Y ALSA++E GQ++L G SALD VTEAVRLL Sbjct: 1 MNTPVIAIHGGAGTITRAAMSPAKQAEYTAALSAVLEAGQRVLADGGSALDAVTEAVRLL 60 Query: 61 EECPLFNAGIGAVFTRDETHELDACVMDGNTLKAGAVAGVSHLRNPVLAARLVMEQSPHV 120 E+CPLFNAG G+V T T+ELDA +MDG TL AGAVA V HLRNPVLAAR VME+S HV Sbjct: 61 EDCPLFNAGRGSVLTHAGTYELDAAIMDGATLGAGAVACVKHLRNPVLAARAVMEKSQHV 120 Query: 121 MMIGEGAENFAFARGMERVSPEIFSTSLRYEQLLAARK-EGATVLDHSGA-----PLDEK 174 + GEGAE FA A+G+E V+P+ + T R +Q AR G T+LDH A P+D Sbjct: 121 LFAGEGAEAFAQAQGLELVTPDYYFTQARTDQWERARAGSGTTLLDHDAATLAAEPIDPD 180 Query: 175 QKMGTVGAVALDLDGNLAAATSTGGMTNKLPGRVGDSPLVGAGCYANNASVAVSCTGTGE 234 K GTVGAVA D G LAAATSTGG+TNK GRVGD+P+VGAGC+A++ + AVS TGTGE Sbjct: 181 TKFGTVGAVAFDAQGRLAAATSTGGVTNKQVGRVGDTPIVGAGCFADDVA-AVSATGTGE 239 Query: 235 VFIRALAAYDIAALMDYGGLSLAEACERVVMEKLPALGGSGGLIAIDHEGNVALPFNTEG 294 +FIR +AAYD+AA M Y G+ L EA RVVMEKLPA+ G GGLIA+D EGNV LPFNTEG Sbjct: 240 MFIRTVAAYDVAAQMRYAGVPLEEAARRVVMEKLPAIEGRGGLIAVDREGNVTLPFNTEG 299 Query: 295 MYRAWGYAGDTPTTGIY 311 MYR + G+ IY Sbjct: 300 MYRGFARVGEPVNVWIY 316 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 317 Length adjustment: 28 Effective length of query: 293 Effective length of database: 289 Effective search space: 84677 Effective search space used: 84677 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory