Align L-asparaginase (EC 3.5.1.1) (characterized)
to candidate RR42_RS12610 RR42_RS12610 glutaminase
Query= reanno::BFirm:BPHYT_RS08815 (347 letters) >FitnessBrowser__Cup4G11:RR42_RS12610 Length = 332 Score = 333 bits (853), Expect = 5e-96 Identities = 187/331 (56%), Positives = 226/331 (68%), Gaps = 5/331 (1%) Query: 17 MPLLPRIVVLATGGTIAGAAASATNTSGYQAGVIGVEQLLAVVPALSTVARMEREQIASV 76 M LLPR+VVLATGGTIAG++++ +++ YQA + V LL VPAL VAR+E EQ+A V Sbjct: 1 MSLLPRVVVLATGGTIAGSSSNPASSAKYQAATVPVTALLDAVPALGAVARIEAEQLAQV 60 Query: 77 DSKDMAMPLWTTLAQRINTLLADDEIDGVVVTHGTDTLEETAYLLHLTIKSDKPVVLTAA 136 DSKDM+ LW+ L +R+ A ++ G+V+THGTDTLEETA LLHL PVVLTAA Sbjct: 61 DSKDMSFALWSRLVERVAFWSAQPDVSGIVITHGTDTLEETAMLLHLACVGTVPVVLTAA 120 Query: 137 MRPASALSADGPLNLLNAVTVAAQASARGQGVLVAFNNRIHSARDVVKTSTYAVDAFHSP 196 MRP+++LSADGPLNLL+AV VAA A A +GVL+ N IH+ RDV+K T AV+AF SP Sbjct: 121 MRPSTSLSADGPLNLLDAVRVAADAGATAKGVLLVINQEIHAGRDVMKAHTSAVNAFVSP 180 Query: 197 EIGALGWVQDGRVEFQRGVVRPHTLATEFVIGAQWPHVEIVLSYAGVSRIAVDALVAAGV 256 G +G+VQD V F R R A + + WP VEIV SYA RI VDAL AGV Sbjct: 181 VSGPIGFVQDNLVRFVRTPSR--LPAKAWPVPGAWPQVEIVASYAEPGRIVVDALAQAGV 238 Query: 257 RGIVVAGTGNGSIHASVQQALADAASQGVAVVRASRVGSGHVMRNGAAADDALGFVSAGS 316 G+VVA GNGS+H S+ +AL DAA GVAVVR+SR G+GHV A FVSAG Sbjct: 239 SGLVVAAAGNGSVHQSLVEALTDAAGAGVAVVRSSRTGAGHVAIPAPPRPAAGVFVSAGD 298 Query: 317 LNPYKARVLLMLALAAG---ATGPMALQKIF 344 LNPYKARVLL LALAA A P ALQ +F Sbjct: 299 LNPYKARVLLALALAAEPGLAKDPAALQALF 329 Lambda K H 0.317 0.129 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 332 Length adjustment: 28 Effective length of query: 319 Effective length of database: 304 Effective search space: 96976 Effective search space used: 96976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory