Align ATPase (characterized, see rationale)
to candidate RR42_RS16370 RR42_RS16370 glutamine ABC transporter ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >FitnessBrowser__Cup4G11:RR42_RS16370 Length = 260 Score = 304 bits (778), Expect = 1e-87 Identities = 154/252 (61%), Positives = 195/252 (77%), Gaps = 2/252 (0%) Query: 10 PVTAIASAPETMIYAEGVEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLN 69 P AS P T I V KW+G + Q L + + VQRGE +V+ GPSGSGKST +R +N Sbjct: 9 PAQDAASQPAT-IELRRVSKWFG-ETQVLSNIDMRVQRGERIVICGPSGSGKSTMIRCIN 66 Query: 70 ALESHQRGEIWIEGHRLSHDRRDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRW 129 LE HQ+GEI +EG L+ R+I+ +R+EVGMVFQQFNLFPHL+VLQNLM+AP+++R Sbjct: 67 RLEEHQQGEILVEGVSLTKSPRNISFVRREVGMVFQQFNLFPHLSVLQNLMIAPMKIRGI 126 Query: 130 PVAQAEATARQLLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALD 189 +AE TAR LERVRI ++AD+YP QLSGGQQQRVAIARAL M+P+++LFDEPTSALD Sbjct: 127 KKKEAEETARHFLERVRIGDKADRYPAQLSGGQQQRVAIARALCMKPKMMLFDEPTSALD 186 Query: 190 PEMVREVLDVMRDLASEGMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQ 249 PEM++EVLDVM LA +GMTM+ THE+GFAR VADR++ M G+IVEEA P+ FF+ P+ Sbjct: 187 PEMIKEVLDVMMQLARDGMTMVCVTHEMGFARTVADRILFMDKGEIVEEAQPEAFFSMPK 246 Query: 250 SDRAKQFLAQIL 261 S+RA+ FL QIL Sbjct: 247 SERARAFLGQIL 258 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 260 Length adjustment: 25 Effective length of query: 236 Effective length of database: 235 Effective search space: 55460 Effective search space used: 55460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory