Align Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized)
to candidate RR42_RS07815 RR42_RS07815 glutamine ABC transporter ATP-binding protein
Query= TCDB::P0AAG3 (241 letters) >FitnessBrowser__Cup4G11:RR42_RS07815 Length = 243 Score = 252 bits (643), Expect = 5e-72 Identities = 126/241 (52%), Positives = 170/241 (70%) Query: 1 MITLKNVSKWYGHFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIKTVNGLEPVQQGEITV 60 MI ++ +SK YG +VL++ E+++GEVV + GPSGSGKST+++ +NGLE Q G IT+ Sbjct: 1 MIKMEQLSKSYGAHRVLSNIDAEIRQGEVVCLIGPSGSGKSTMLRCINGLEQYQGGSITI 60 Query: 61 DGIVVNDKKTDLAKLRSRVGMVFQHFELFPHLSIIENLTLAQVKVLKRDKAPAREKALKL 120 DG VN + ++R RV MVFQ F LFPH + +EN+ V V K A A+E+A ++ Sbjct: 61 DGERVNAASPGIRQIRQRVSMVFQRFNLFPHRTALENVMEGPVHVKKESVAEAKERAAEI 120 Query: 121 LERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEPTSALDPEMINEVLDVMV 180 L VGL+ +P QLSGGQQQRVAIARAL M P A+LFDEPTSALDPE++ EVL VM Sbjct: 121 LASVGLAEKMAHYPTQLSGGQQQRVAIARALAMRPDAILFDEPTSALDPELVGEVLGVMR 180 Query: 181 ELANEGMTMMVVTHEMGFARKVANRVIFMDEGKIVEDSPKDAFFDDPKSDRAKDFLAKIL 240 +LA +GMTM++VTHEM FAR+V+NRV+F+D G+I E P P ++R +DFL ++ Sbjct: 181 KLAEKGMTMVIVTHEMKFAREVSNRVLFLDGGRIAEQGPSAQVLTQPSNERMQDFLRRVT 240 Query: 241 H 241 H Sbjct: 241 H 241 Lambda K H 0.320 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 243 Length adjustment: 23 Effective length of query: 218 Effective length of database: 220 Effective search space: 47960 Effective search space used: 47960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory