Align TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate RR42_RS07935 RR42_RS07935 peptide ABC transporter ATPase
Query= TCDB::Q9WXN5 (330 letters) >FitnessBrowser__Cup4G11:RR42_RS07935 Length = 361 Score = 213 bits (542), Expect = 6e-60 Identities = 115/303 (37%), Positives = 181/303 (59%), Gaps = 16/303 (5%) Query: 22 VKAVDGLSFEILEDEVIGVVGESGCGKTTLSNVIFMNMVKPLTLVDGKIFLRVNGEFV-E 80 V+AVDG+SFE+ + E +GVVGESGCGK+T + ++ ++ + +GE + + Sbjct: 49 VRAVDGVSFEVRKGETLGVVGESGCGKSTTARLLM------------QLIEQNSGELIFD 96 Query: 81 LSSMTRDEVKRKFWGKEITIIPQAAMNALMPTIRMEKYVRHLAESHGIDEEELLDKARRR 140 + ++ K + ++ ++ Q + ++L P + +E+ + A HGID E +AR Sbjct: 97 ALGVGSAQLPMKRYRSQVQMVFQDSYSSLNPRLTIEESIAFTARVHGIDAAEASARARAL 156 Query: 141 FEEVGLDPL-WIKRYPFELSGGMRQRAVIAIATILNPSLLIADEPTSALDVVNQKVLLKV 199 + VGL+P + RYP ELSGG RQR IA A +L P L+I DE SALD + +L + Sbjct: 157 LDRVGLEPTRFAGRYPHELSGGQRQRVNIARALVLRPRLVILDEAVSALDKSVEAQVLNL 216 Query: 200 LMQMKRQGIVKSIIFITHDIATVRQIADRMIIMYAGKIVEFAPVESLLEKPLHPYTQGLF 259 L+++K + + + +FI+HD+ +R + DR+++MY GK+VE E+L P HPYT+ L Sbjct: 217 LLELKAEFDL-TYVFISHDLNVIRYLCDRVMVMYLGKVVEVGDTETLYANPAHPYTRALL 275 Query: 260 NSVLTPEPEVKKRGITTIPGAPPNLINPPSGCRFHPRCPHAMDVCKEKEPPLTEIEPGRR 319 S+ +P+ + + + + G PPN INPPSGC FHPRC A DVC + P L++ G Sbjct: 276 ASMPAMDPDHRTQ-VAPLAGDPPNPINPPSGCSFHPRCAMAQDVCSRRAPQLSDALAGHP 334 Query: 320 VAC 322 VAC Sbjct: 335 VAC 337 Lambda K H 0.321 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 361 Length adjustment: 29 Effective length of query: 301 Effective length of database: 332 Effective search space: 99932 Effective search space used: 99932 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory