Align CbtF, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate RR42_RS35215 RR42_RS35215 peptide ABC transporter ATP-binding protein
Query= TCDB::Q97VF4 (324 letters) >FitnessBrowser__Cup4G11:RR42_RS35215 Length = 329 Score = 177 bits (450), Expect = 2e-49 Identities = 111/332 (33%), Positives = 181/332 (54%), Gaps = 20/332 (6%) Query: 3 LMELKGVSVIFEDKVGLFKKRKFYALK---DVSLSMNQGDLLIVLGESGAGKTTLGRVIV 59 ++ ++ + V F G+F KR+ ++K VS ++ +G+ L ++GESG GK+T G I+ Sbjct: 5 ILRVENLKVHFPVTQGVFIKRQVGSVKAVDGVSFTLRRGETLGLVGESGCGKSTTGLAII 64 Query: 60 GLQKPTSGEVVYDGYNIWKNKRKIFKKYRKDVQLIPQDPYSTLPFNKTVEEILVAPILRW 119 + + G + +DG + + K +R+ VQ++ QDP+ +L V +I+ P+ Sbjct: 65 KMLAASGGRIAFDGDDFATFSKAQEKNFRRSVQMVYQDPFGSLNPRMKVCDIIGEPLEVH 124 Query: 120 EKIN-KDELRKRLINLLELVKLTPAEEFLGKYPHQLSGGQKQRLSIARSLSVNPRIIVAD 178 N ++ R R+ LL++V L P +YPH+ SGGQ+QR+ IAR+L+V P +IV D Sbjct: 125 GMANDREHYRARIAELLQMVGLLPY--MADRYPHEFSGGQRQRIGIARALAVEPSLIVCD 182 Query: 179 EPVTMVDASLRIGILNTLAEIKNRLNLTMVFITHDIPIARYFYHLFDKGNTIVMFAGRIV 238 EPV+ +D S++ ++N E++ RL LT +FI HD+ + R H+ D+ VM+ GRIV Sbjct: 183 EPVSALDVSIQAQVVNVFMELQRRLGLTYIFIAHDLAVVR---HISDR--IAVMYLGRIV 237 Query: 239 ERADLEEILKDPLHPYTNDLIKLTP--SIDNLYKEINVKINYE-----RVEKGCPYRLRC 291 E A + + +P HPYT L+ P S++ K + + E GC + RC Sbjct: 238 EIASRDALYANPRHPYTKALLSAVPVASVEAEAKRQRIVLKGEVPSPLNPPSGCRFHPRC 297 Query: 292 PFAMDICKNEEPKLFKY--SHEVACFLYGKVG 321 A C+ E+P L + VAC L G G Sbjct: 298 AQATQRCRVEDPVLRERGDGQMVACHLEGLEG 329 Lambda K H 0.321 0.141 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 329 Length adjustment: 28 Effective length of query: 296 Effective length of database: 301 Effective search space: 89096 Effective search space used: 89096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory