Align ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized)
to candidate RR42_RS37305 RR42_RS37305 sulfate ABC transporter ATP-binding protein
Query= reanno::WCS417:GFF4321 (386 letters) >FitnessBrowser__Cup4G11:RR42_RS37305 Length = 366 Score = 230 bits (587), Expect = 4e-65 Identities = 136/300 (45%), Positives = 185/300 (61%), Gaps = 11/300 (3%) Query: 2 ATLELRNVNKTYG-AGLPDTLKNIELSIKEGEFLILVGPSGCGKSTLMNCIAGLETITGG 60 A L + V K +G AG L + LS+ +GE L L+GPSGCGK+TL+ IAGLE G Sbjct: 11 AFLAVEQVGKRFGGAGGFQALDGVSLSVAQGELLCLLGPSGCGKTTLLRIIAGLEREDTG 70 Query: 61 AIMIGDQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKIRKMPQADIDAEVARVA 120 I G ++++G+ P+ RD ++FQSYAL+P +SV N+ +GL+ R M +A +A VA + Sbjct: 71 RIHAGGRELTGLPPQARDYGILFQSYALFPNLSVARNVAYGLQGRGMGRAHREARVAEML 130 Query: 121 KLLQIEHLLNRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL 180 L+ + + PGQLSGGQQQRVA+ RALA P + L DEP+S LDA++R +R E++ Sbjct: 131 SLVGLAGSERKFPGQLSGGQQQRVALARALAPAPSLLLLDEPMSALDARVREHLRLELRQ 190 Query: 181 MHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKEIYNNPANQFVASFIGSPP 240 + +RL TTV VTHDQ EAM + D++AVM+ G I Q GTP EIY PA+ FVA FIG Sbjct: 191 LQRRLNVTTVMVTHDQDEAMAMADRIAVMEGGRIAQVGTPGEIYERPASAFVAEFIGQ-- 248 Query: 241 MNFVPLRLQRKDGRLVALLDSGQARCELALNTTEAG-LEDRDVILGLRPEQIMLAAGEGD 299 N++ RL +D V LD LA++ A + D L RPE I L EG+ Sbjct: 249 ANWLDGRLSGRDTFSVGELD-------LAVSPARASEVADGAARLCCRPEAIRLHPVEGE 301 Lambda K H 0.318 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 354 Number of extensions: 23 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 366 Length adjustment: 30 Effective length of query: 356 Effective length of database: 336 Effective search space: 119616 Effective search space used: 119616 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory