Align 2-ketogluconokinase (EC 2.7.1.13) (characterized)
to candidate RR42_RS09470 RR42_RS09470 2-dehydro-3-deoxygluconokinase
Query= metacyc::MONOMER-12748 (320 letters) >FitnessBrowser__Cup4G11:RR42_RS09470 Length = 314 Score = 332 bits (851), Expect = 7e-96 Identities = 170/302 (56%), Positives = 209/302 (69%), Gaps = 1/302 (0%) Query: 2 PDIDILSFGETMAMFVAEHGGDLAQVQHFHKRIAGADSNVAIGLARLGFKVAWLSRVGND 61 PD+D+++ GE M M VA G L VQ FHKR AGA++NVAIGL+RLG KV W SR+G+D Sbjct: 3 PDLDVVTLGEAMLMLVAGEAGPLEGVQTFHKRTAGAETNVAIGLSRLGLKVGWASRLGDD 62 Query: 62 SLGRFVLDTLRAEGLDCRFVRCDPIHPTGFQLKSREDGGDDPRVEYFRRGSAASHLAISD 121 S+ R++L +R EG+DC V C+P TGFQ K R D G DP VEY RRGSAAS + Sbjct: 63 SMARYLLGEMRREGVDCSQVVCEPGERTGFQFKGRVDDGSDPPVEYHRRGSAASRMNPEH 122 Query: 122 LDPALLR-ARHLHATGIPPALSDSARELSGHLMHTQRSAGHSVSFDPNLRPALWPSEALM 180 LD LR ARHLH TG+ PAL++ + + + T R+AG +VSFDPNLRPALW + LM Sbjct: 123 LDDRWLRRARHLHVTGVFPALAEGTQAATRQAIATMRAAGRTVSFDPNLRPALWATPELM 182 Query: 181 IREINRLAALAHWVLPGLAEGRLLTGRDDPADIAAFYLDQGAEAVVIKLGAHGAYYRTQL 240 +N LA WVLPG+ EGR LTG +P IAAFY +GA VV+KLGA GAY+ + Sbjct: 183 RETLNNLAQQCDWVLPGIEEGRFLTGHAEPERIAAFYRGRGARLVVVKLGAEGAYFDGEA 242 Query: 241 DAGFVEGVPVAQVVDTVGAGDGFAVGLISALLESRGILEAVQRANWIGSRAVQSRGDMEG 300 G V V +VVDTVGAGDGFAVG+ISALL+ R + +AV+R WIG+RAVQ RGD EG Sbjct: 243 GTGHVPAFSVERVVDTVGAGDGFAVGVISALLQGRTVADAVRRGAWIGARAVQVRGDTEG 302 Query: 301 LP 302 LP Sbjct: 303 LP 304 Lambda K H 0.321 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 379 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 314 Length adjustment: 27 Effective length of query: 293 Effective length of database: 287 Effective search space: 84091 Effective search space used: 84091 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory