Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate RR42_RS18605 RR42_RS18605 sugar ABC transporter permease
Query= uniprot:A3DE71 (289 letters) >FitnessBrowser__Cup4G11:RR42_RS18605 Length = 295 Score = 143 bits (360), Expect = 5e-39 Identities = 83/288 (28%), Positives = 150/288 (52%), Gaps = 16/288 (5%) Query: 6 YFESMKRKKKIKDTIANIILAILVVLTLGPIVFMVLTSLMDHNAI----ARGKWIAPTRF 61 Y +SM R+ I L I V + L P +M +T+ + A W+ F Sbjct: 18 YLQSMPRRW----VTIYIPLGIFVFVLLFPFYWMAITAFKPDGELLMRSANPFWVMAPTF 73 Query: 62 SNYVEVFQKLPFGIYFRNSLIVCSIVMVVALVIATLAGYSLAKYKFPGSGFFGILILATQ 121 +++ ++ P+ + N++IV +I +L + LA Y++ + +F G+ G+ + Sbjct: 74 AHFKKLLFDTPYPEWLLNTVIVSTISTFASLAASVLAAYAIERLRFQGAKQVGLAVFLAY 133 Query: 122 LLPGMMFLLPLYLDFVKIKQATGIQLINSIPGLVIVYSAFFVPFSIWIIRGFFASIPGEL 181 L+P + +PL ++ L ++ L++ Y F +PF W++ G+F SIP EL Sbjct: 134 LIPPSILFIPLASIVFQLG------LFDTRWALILTYPTFLIPFCTWLLMGYFRSIPYEL 187 Query: 182 EEAARIDGCNKFTAFLRVMLPLAVPGIVATAIYIFLTAWDELIFAWVLLKDTKVTTIPAG 241 EE A IDG ++ ++++LPLAVPG+++ I+ F +W+E I+A + ++V T+P G Sbjct: 188 EECALIDGATRWEILVKIILPLAVPGLISAGIFAFTLSWNEFIYALTFISSSEVKTVPVG 247 Query: 242 I-RGFIAYTTARYDLLMAAGTIVTIPVLIMFFTMQKKFISGMTAGAVK 288 I I + LMA + ++PV +++ + ++SGMT GAVK Sbjct: 248 IVTELIEGDVYHWGALMAGALLGSLPVALVYSFFVEYYVSGMT-GAVK 294 Lambda K H 0.332 0.145 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 295 Length adjustment: 26 Effective length of query: 263 Effective length of database: 269 Effective search space: 70747 Effective search space used: 70747 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory