Align Fe(3+) dicitrate transport system permease protein FecC; Iron(III) dicitrate transport system permease protein FecC (characterized)
to candidate RR42_RS16135 RR42_RS16135 ABC transporter permease
Query= SwissProt::P15030 (332 letters) >FitnessBrowser__Cup4G11:RR42_RS16135 Length = 335 Score = 179 bits (453), Expect = 1e-49 Identities = 121/342 (35%), Positives = 185/342 (54%), Gaps = 20/342 (5%) Query: 1 MTAIKHPVLLWGLPVAALIIIFWLSLFCYSAIPVSGADATRALLPGHTPTLPEALVQNLR 60 M ++ + +W + AA + +F LSL ++P+SGA AL G T A+V+ LR Sbjct: 1 MPDMRRALAIWLMLAAAGVAVFLLSL-AVGSVPLSGAQVWHALCGGADDTAG-AIVRELR 58 Query: 61 LPRSLVAVLIGASLALAGTLLQTLTHNPMASPSLLGINSGAALAMALTSALSPTPIAGYS 120 LPR+ A G LAL G L+Q L NP+A P +LG++ GAA ALT+ L P+ ++ Sbjct: 59 LPRAAAAFACGGLLALTGALMQVLLRNPLAEPYVLGVSGGAATG-ALTAMLMMWPL--WT 115 Query: 121 LSFIAACGGGVSWLLVMTAG----------GGFRHTHDRNKLILAGIALSAFCMGLTRIT 170 + AA G S +LV T GG H ++L+L G+ L+A L + Sbjct: 116 VQAGAAGGALFSMVLVATLARRDLLHPQVQGG--HHEAGSRLLLTGVILAAGWGALITLI 173 Query: 171 LLLA-EDHAYGIFYWLAGGVSHARWQDVWQLLPVVVTAVPVVLLLANQLNLLNLSDSTAH 229 L +A E G+ +WL G + + L + AV + + +A LN + + ++ A Sbjct: 174 LSVAPEARLRGMLFWLTGDLGGTASYGL--ALGALALAVLLAMPMARSLNAMLMGETVAQ 231 Query: 230 TLGVNLTRLRLVINMLVLLLVGACVSVAGPVAFIGLLVPHLARFWAGFDQRNVLPVSMLL 289 LGV + +RL + +L L + ++ AG + F+GL+VPHL R G DQR +LP S LL Sbjct: 232 ALGVRVGAVRLSVFVLASLAIAVAITSAGSIGFVGLVVPHLVRLAWGNDQRLMLPASALL 291 Query: 290 GATLMLLADVLARALAFPGDLPAGAVLALIGSPCFVWLVRRR 331 G TL++ AD++AR + P LP G + AL+G P F++L+ RR Sbjct: 292 GGTLLMAADLVARTVIAPAQLPVGVITALLGVPTFLFLLLRR 333 Lambda K H 0.327 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 335 Length adjustment: 28 Effective length of query: 304 Effective length of database: 307 Effective search space: 93328 Effective search space used: 93328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory