Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate RR42_RS16445 RR42_RS16445 hypothetical protein
Query= reanno::pseudo3_N2E3:AO353_03040 (254 letters) >FitnessBrowser__Cup4G11:RR42_RS16445 Length = 252 Score = 242 bits (617), Expect = 6e-69 Identities = 121/251 (48%), Positives = 177/251 (70%) Query: 4 LEVQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLN 63 ++V+DL+K + + + L GV+L+ G+V+ +IG SGSGKST LR IN LE+P G I ++ Sbjct: 2 IDVRDLYKHFDAVKALNGVNLEVQRGEVVCLIGPSGSGKSTLLRSINYLERPTRGDISID 61 Query: 64 NEELKLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSK 123 + + V + ++L R+RS + MVFQ F LW H++ +EN+ V V G+ Sbjct: 62 GQTVGHVNQAGKKARPMSGRELARVRSEVGMVFQMFYLWPHLSVLENVTLGMVEVRGVRL 121 Query: 124 AEAREKAELYLAKVGVSHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDPE 183 A+A ++ LAKVG+S + DAYP +SGG++QRVAIARALAM+P+++LFDEPTSALDPE Sbjct: 122 ADAAQRGRQLLAKVGLSGKYDAYPEQLSGGQRQRVAIARALAMDPKIILFDEPTSALDPE 181 Query: 184 LVGDVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQSE 243 VG+VL+ M+ +A EG TM+V THEMGFAR V++++VF+ +G V E+G+P ++ PQS Sbjct: 182 RVGEVLQTMETVAAEGMTMIVATHEMGFARRVADRVVFMDEGRVVEAGSPGDIFDRPQSA 241 Query: 244 RLQQFLSGSLK 254 RL+QFL L+ Sbjct: 242 RLKQFLDKVLQ 252 Lambda K H 0.317 0.131 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 252 Length adjustment: 24 Effective length of query: 230 Effective length of database: 228 Effective search space: 52440 Effective search space used: 52440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory