Align ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized)
to candidate RR42_RS31740 RR42_RS31740 ABC transporter permease
Query= reanno::pseudo1_N1B4:Pf1N1B4_3432 (229 letters) >FitnessBrowser__Cup4G11:RR42_RS31740 Length = 222 Score = 120 bits (301), Expect = 2e-32 Identities = 76/216 (35%), Positives = 119/216 (55%), Gaps = 13/216 (6%) Query: 9 ILDGVWLTLQLALSSMVLAIVLGLIGVALRLSPIRWLAW-LGDLYSTVIRGIPDLVLILL 67 ++ G +T+++ ++VL V+GL+ RL P R + + L Y T IRG P LV + L Sbjct: 15 LVRGAGVTVEVTACALVLGCVMGLLVGIGRLDPRRRVVYGLCTAYVTAIRGTPLLVQLFL 74 Query: 68 IFYGGQDLLNRVAPMFGYDDYIDLNPLAAGIGTLGFIFGAYLSETFRGAFMAIPKGQAEA 127 +F+G P F I L G+ LG GAY+SE RGA ++ KGQ EA Sbjct: 75 LFFG--------LPQFD----ILLPAFVCGVIGLGIYSGAYVSEIVRGAIQSVDKGQMEA 122 Query: 128 GMAYGMSSFQVFFRVLVPQMIRLAIPGFTNNWLVLTKATALISVVGLQDMMFKAKQAADA 187 + GMSS Q V++PQ I IP N ++ L K +AL+S++ + D+M + ++ Sbjct: 123 ARSIGMSSGQAMRAVILPQAIVRMIPPLGNEFIALIKNSALVSLLTIHDVMHEGQKIISV 182 Query: 188 TREPFTFFLAVAAMYLVITSVSLLALRHLEKRYSVG 223 + +LA+A +YL++TS + L LRH+E+R +G Sbjct: 183 SYRSLEVYLAIALVYLLLTSAAGLFLRHMEQRLRMG 218 Lambda K H 0.329 0.144 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 229 Length of database: 222 Length adjustment: 22 Effective length of query: 207 Effective length of database: 200 Effective search space: 41400 Effective search space used: 41400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory