Align ABC transporter for L-Arginine and L-Citrulline, periplasmic substrate-binding component (characterized)
to candidate RR42_RS31745 RR42_RS31745 ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_03055 (258 letters) >FitnessBrowser__Cup4G11:RR42_RS31745 Length = 249 Score = 110 bits (275), Expect = 3e-29 Identities = 82/252 (32%), Positives = 129/252 (51%), Gaps = 14/252 (5%) Query: 2 KKLVLLGALALSVLS-LPTFADEKPLKIGIEAAYPPFASKAPDGSIVGFDYDIGNALCEE 60 +K +L+G + LS+ + L D L++ +A +PP +G GFD ++ AL + Sbjct: 5 RKCLLIGLMGLSLAAGLARAQDNAVLRVATDATFPPMEF-VENGKRTGFDVELVEALAKT 63 Query: 61 MKVKCVWVEQEFDGLIPALKVRKIDAILSSMSITDDRKKSVDFTNKYYNTPARLVMKAGT 120 M + W + +F GLIP L R+ D +S + IT++R+K VDFT+ YY ++K+G Sbjct: 64 MGKRVEWTDIDFKGLIPGLISRRFDMAVSGIYITEERRKVVDFTDPYYTGGLVALVKSGN 123 Query: 121 QVSDNLAELKGKKIGVQRGSIHNRFAEEVLKPLGAEIKPYGSQNEIYLDVAAGRLDGTVA 180 + A+L GKK+ VQ G+ F E P ++ +Q E++ V GR D V Sbjct: 124 TAINTPADLNGKKVSVQVGTKSVNFLRENY-PQVQRVEVEKNQ-EMFNLVEIGRADAAV- 180 Query: 181 DATLLDDGFLKTDSGKGFAFVGPAFTDEKYFGDGIGIAVRKGDKAELDK-INAAIVAIRA 239 T + G V A T E+Y G+AVRK D EL + +NAA+ ++A Sbjct: 181 --TGKPAAMQYVKARGGMRVVEKALTTEEY-----GMAVRK-DTPELTRAVNAALTKLKA 232 Query: 240 NGKYKQIQDKYF 251 +G Y Q+ K+F Sbjct: 233 DGTYAQLVQKWF 244 Lambda K H 0.318 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 249 Length adjustment: 24 Effective length of query: 234 Effective length of database: 225 Effective search space: 52650 Effective search space used: 52650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory